SecReT6
Protein ID: 78047699
SecReT6 ID101
T6SS typei3
Gene symbol-
Locus tagXCV2143
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T6SS(s) in this replicon]
Location [Strand]2459341..2460369 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ3BTN9
KEGG IDxcv:XCV2143
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.20E-20, Aligned region: 55..113
Protein Sequence: 342 a.a.     [Download]
>gi|78047699|ref|YP_363874.1| hypothetical protein XCV2143 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MQIDSEQLLQPVDAQAPSGPNLEYTPEFQSLEELARPRQERALGAGVLVPEAPEWRQVADSAEHLLLRSK
DLRLGILLSIARLHQDGLVGWSSGVSLLRHLLERFWDDVHPGLDADEDNDPTERVNAIAALADSERTLTQ
LRNVRLFKGLHPGHFSLRDLRIVQGTLKRAADDPSEAPEPAAIDACLRDCPLEALLELDAALAAAQGDIA
AMAGLFAERTPGYGPELAPLTHDLGELRAFLRPYVAERFGSTADPAEHAASVADGANAPAPRAHALEHPD
DVRRMLDQLCDYYARREPSSPVPLLLRRAQRLVGLDFAALMRDLAPRGIDELQVVSGQDHSD
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|78045556|ref|NC_007508.1|:c2460369-2459341 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGCAGATCGACAGCGAACAGCTACTGCAGCCGGTGGACGCACAGGCGCCGTCCGGTCCGAACCTGGAAT
ACACCCCGGAGTTCCAGAGCCTGGAAGAACTGGCACGCCCGCGTCAGGAACGCGCACTGGGCGCGGGCGT
GCTGGTGCCCGAGGCGCCGGAGTGGCGTCAGGTCGCCGACAGCGCCGAGCACTTGTTGCTGCGCTCCAAG
GACTTGCGACTGGGCATCTTGCTGAGCATTGCCCGCCTGCACCAGGACGGCCTGGTGGGCTGGTCCAGCG
GCGTCAGCCTGCTCCGGCACCTGCTGGAGCGGTTCTGGGACGACGTCCATCCTGGTCTGGATGCCGATGA
GGACAACGACCCGACCGAACGCGTCAACGCCATCGCGGCGCTGGCCGACAGCGAGCGCACGCTGACGCAG
CTGCGCAACGTCCGCCTGTTCAAGGGACTGCATCCTGGGCACTTTTCGCTGCGCGATCTGCGCATCGTGC
AGGGCACGCTCAAGCGCGCTGCGGACGATCCCAGCGAAGCGCCAGAGCCGGCCGCCATCGATGCCTGCCT
GCGCGACTGTCCGCTGGAGGCGCTGCTGGAGCTGGATGCGGCCCTGGCCGCTGCGCAGGGCGATATCGCC
GCGATGGCCGGCCTGTTCGCCGAGCGCACCCCGGGATATGGACCGGAGCTGGCGCCGTTGACGCACGACC
TGGGCGAGTTGCGCGCGTTCCTGCGGCCTTATGTCGCCGAGCGTTTCGGCTCCACGGCCGACCCAGCCGA
GCATGCAGCATCCGTCGCCGACGGCGCCAATGCACCCGCACCGCGGGCGCACGCCCTGGAGCATCCGGAC
GACGTTCGCCGCATGCTCGATCAGCTGTGCGATTACTACGCGCGGCGCGAGCCTTCCAGCCCGGTGCCGT
TGTTGTTGCGGCGCGCGCAACGGCTGGTCGGCCTGGATTTTGCCGCGCTGATGCGCGACCTGGCGCCACG
CGGGATCGACGAGCTGCAGGTGGTGTCGGGCCAGGACCATTCCGATTAG