SecReT6
Protein ID: 78049766
SecReT6 ID102
T6SS typeN/A
Gene symbol-
Locus tagXCV4210
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T6SS(s) in this replicon]
Location [Strand]4833826..4835082 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ3BMS2
KEGG IDxcv:XCV4210
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.20E-69, Aligned region: 40..244
DUF2077 [PF09850], Evalue: 1.20E-69, Aligned region: 367..405
OmpA [PF00691], Evalue: 1.60E-11, Aligned region: 309..397
Protein Sequence: 418 a.a.     [Download]
>gi|78049766|ref|YP_365941.1| hypothetical protein XCV4210 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MSRPVADLAPAYAAPLPAAEGGGVPSEDTDISELLGRSVNPLVQAATPLLLLAVQLRHSAQSPDVARLRE
QVMAQVRRFEQRARDGGAPVEAVTAARYVLCALLDEAVLNAPWGERSGWSQKTLLVTFHSESYGGAKFFQ
ILERLCADVPRHLDLIELMYLCLALGFVGRYQIESGGMVTLAAIQDDVYRRIRAARGPAPDSLAPRWRGV
EDRRRLGRYLPVWAAALLGVSVVVVTFVWLQARLNSLSAPISAQAAQWGIAPATPPDAAPVPPPVRLKQL
LSAQERAGLLRVDEQADGQTRVRLSSAAMFASGGVEVEPQQRGLIAQIAAAIEQLPGRVIVVGHTDDVPV
RSLRFQDNYALSAARAQALAQVLQAQLSTPGRVDAIGAGDSQPIARPVQLPANRARNRRVEILFQPGE
 
Nucleotide Sequence: 1257 bp     [Download]
>gi|78045556|ref|NC_007508.1|:c4835082-4833826 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGAGCCGACCTGTTGCCGATCTGGCGCCTGCCTACGCCGCACCGCTGCCGGCCGCAGAGGGCGGCGGCG
TGCCCAGCGAAGATACCGACATCAGCGAACTGCTGGGCCGCAGCGTCAACCCGTTGGTGCAGGCCGCCAC
GCCGCTGCTGCTGTTGGCGGTGCAGTTGCGCCACAGCGCGCAATCGCCCGATGTGGCCCGCCTGCGCGAG
CAGGTGATGGCGCAGGTGCGCCGCTTCGAACAACGTGCACGCGATGGCGGCGCGCCGGTGGAGGCGGTCA
CCGCCGCGCGCTACGTGTTGTGCGCGCTGCTGGACGAAGCGGTGCTCAATGCGCCGTGGGGCGAGCGCAG
CGGCTGGTCGCAGAAGACCTTGCTGGTGACCTTCCACAGCGAATCGTACGGCGGCGCCAAGTTCTTCCAG
ATCCTGGAGCGCTTGTGCGCCGATGTGCCACGGCATCTGGACTTGATCGAGCTGATGTACCTGTGCCTGG
CGCTGGGGTTTGTCGGCCGCTACCAGATCGAGTCCGGCGGCATGGTGACGCTGGCGGCCATCCAGGACGA
TGTCTATCGCCGCATCCGTGCGGCGCGCGGCCCGGCGCCGGACAGCCTGGCCCCGCGTTGGCGCGGGGTG
GAAGACCGCCGCCGGCTGGGCCGTTATCTGCCGGTGTGGGCGGCTGCGTTGCTGGGGGTGAGCGTGGTGG
TGGTGACGTTCGTGTGGTTGCAGGCGCGTTTGAACAGCCTGTCCGCACCGATCAGTGCGCAGGCTGCCCA
ATGGGGCATTGCGCCGGCCACGCCACCGGACGCTGCGCCCGTGCCGCCGCCGGTGCGGCTCAAGCAGTTG
CTCTCCGCGCAGGAACGCGCCGGCCTGCTGCGCGTGGACGAACAGGCCGACGGGCAGACGCGCGTGCGCC
TGAGCAGCGCGGCGATGTTCGCCTCCGGCGGGGTGGAGGTGGAGCCGCAGCAGCGCGGCTTGATCGCGCA
GATTGCAGCGGCCATCGAGCAATTGCCGGGGCGGGTGATCGTGGTCGGGCACACCGACGACGTGCCGGTG
CGCTCGCTGCGCTTCCAGGACAACTACGCCTTGTCGGCCGCACGTGCGCAGGCGCTTGCGCAGGTGTTGC
AGGCGCAGCTGAGTACGCCGGGGCGGGTGGACGCCATCGGCGCTGGCGATTCGCAACCGATCGCACGGCC
AGTGCAATTGCCGGCCAACCGCGCGCGCAATCGCCGCGTGGAGATCCTGTTCCAGCCTGGGGAATGA