SecReT6
Protein ID: 78049767
SecReT6 ID102
T6SS typeN/A
Gene symbol-
Locus tagXCV4211
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T6SS(s) in this replicon]
Location [Strand]4835085..4836419 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ3BMS1
KEGG IDxcv:XCV4211
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.50E-153, Aligned region: 18..443
Protein Sequence: 444 a.a.     [Download]
>gi|78049767|ref|YP_365942.1| hypothetical protein XCV4211 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MQNNKVVWSEGLFLRPQHLQQQERYLERYVDLRAARLRPHAWGVSELEWETDLLAVGKLGLRRARGVFAD
GTPFAMPCDDPLPVALEVEPTCRDQIVYLTVPLRVPAQPELGRPESPADQLFRYRVRETESNDASGSTSE
AVLMEVGGLSTRLLPHSQPLEGLDRIAVARIIETRADRQVVLDPHFIPSAMVCQAAPRLTTFLTELLGLL
HQRGEALASRVTLTDRGGAADIADFLLLQLVNRWQPQMAHWAAAPLAHPEELFRALVALAGELSTFTAAG
KRPPAWPAYRHESQQDSFEPVIGALRSSLSAVLEQTATPLPIQARKFGVWVAMVPDPGLLDSAAFVLAAK
ADMPSEELRRQLPAHAKIGPVEQIRDLVNLQLPGIVATPMPVAPRQIPYHAGYLYFEFDKSAALWRTLKT
SGGIAFHFGSEFAGLDLQLWAIRS
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|78045556|ref|NC_007508.1|:c4836419-4835085 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGCAGAACAACAAGGTCGTGTGGAGCGAAGGGCTGTTCCTGCGCCCGCAGCATCTGCAGCAGCAGGAGC
GCTACCTGGAGCGCTACGTCGACCTGCGTGCGGCGCGGTTGCGGCCCCATGCCTGGGGCGTGAGCGAGCT
GGAATGGGAGACCGATCTGCTGGCGGTCGGCAAGCTGGGCCTGCGGCGTGCGCGTGGCGTGTTCGCCGAT
GGCACGCCCTTCGCCATGCCTTGCGACGACCCGCTGCCGGTGGCGCTGGAGGTCGAGCCCACTTGCCGCG
ACCAGATCGTCTATCTCACCGTGCCGCTGCGGGTGCCGGCGCAACCCGAACTGGGGCGCCCGGAATCGCC
GGCCGATCAGCTGTTTCGCTACCGCGTGCGCGAGACCGAGAGCAACGACGCCTCCGGTAGCACCAGCGAA
GCGGTGTTGATGGAAGTCGGCGGGTTGAGCACGCGGTTGCTGCCGCACTCGCAGCCGTTGGAAGGGCTGG
ACCGCATCGCGGTGGCGCGCATCATCGAGACGCGCGCCGACCGCCAGGTGGTGCTGGACCCGCATTTCAT
TCCCAGCGCGATGGTGTGCCAGGCGGCGCCGCGCTTGACCACGTTTCTCACCGAGCTGCTCGGCCTGTTG
CATCAGCGCGGTGAAGCGCTGGCATCGCGCGTGACGCTGACCGATCGCGGCGGTGCTGCCGATATCGCAG
ACTTTCTGTTGCTACAGCTGGTCAACCGTTGGCAGCCGCAGATGGCGCATTGGGCCGCCGCGCCATTGGC
GCATCCGGAAGAGCTGTTCCGCGCCCTGGTGGCGCTGGCCGGCGAATTGAGCACGTTCACCGCTGCCGGC
AAGCGCCCCCCTGCATGGCCCGCCTATCGGCACGAATCGCAGCAGGACAGTTTCGAGCCAGTGATCGGCG
CCCTGCGCAGCAGCCTGAGCGCAGTGCTGGAACAGACCGCCACGCCGCTGCCGATCCAGGCGCGCAAGTT
CGGCGTGTGGGTGGCGATGGTGCCGGACCCGGGCCTGCTCGACAGCGCGGCGTTCGTGCTCGCGGCCAAG
GCCGACATGCCCAGCGAAGAGTTGCGCCGGCAATTGCCCGCGCACGCCAAGATCGGGCCGGTGGAGCAGA
TTCGCGATCTGGTCAATCTGCAGTTGCCCGGCATCGTGGCCACGCCCATGCCGGTGGCGCCGCGACAGAT
TCCGTATCACGCCGGCTATCTGTATTTCGAATTCGACAAGAGCGCAGCGTTGTGGCGAACGCTGAAGACC
TCCGGCGGTATCGCATTCCACTTCGGCAGCGAATTCGCCGGGCTGGACCTGCAACTGTGGGCGATCCGGA
GCTGA