SecReT6
Protein ID: 78049770
SecReT6 ID102
T6SS typeN/A
Gene symbol-
Locus tagXCV4214
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T6SS(s) in this replicon]
Location [Strand]4839002..4840333 [-]
Producthypothetical protein
NoteFha
UniProt IDQ3BMR8
KEGG IDxcv:XCV4214
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.20E-15, Aligned region: 32..95
Protein Sequence: 443 a.a.     [Download]
>gi|78049770|ref|YP_365945.1| hypothetical protein XCV4214 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MSSSQLILTVSGAQAAQFGASAQKRFAGTGGSIGRSDESDWVLAAPGVSRTHAVVRFLNGMYFIEDRSTN
GMSLNGTALTRADPSALSDGDRLQLDSFEIQVQVQSLAAASPATPVFDPLPDAMDDRTQVAPPPSTLRAP
SATAGFELLEFGTPPAARPAVDAVLDELLLSGASRELDPLRLLDPLPAPARDASPSAWNQSNARHDHFRP
PASPDARATLPENWDMTLGDFAPPAPLPAVSPMAAPVVSPFTSPAAPVAAAASAATTVPPELDRIFAIVV
DGVMDVLRARAEIKNTFRLPVTVIQRSENNPLKFAATAEDALQKLLAPPSASFLSGVPAFEDAFDDIRCH
QMAMLAGMRAAFDAMLFHFSPDRLEQEADAGGKRLSFGGKGRYWERYRDNFEQLRSDPDECFRRLFGDEF
ARAYEAQLARLKSARRQPAGRGI
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|78045556|ref|NC_007508.1|:c4840333-4839002 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
GTGTCCAGTTCGCAGTTGATCCTCACCGTCAGCGGCGCGCAGGCCGCGCAGTTCGGCGCCAGCGCGCAGA
AGCGCTTTGCCGGCACCGGCGGCAGCATCGGCCGCTCCGACGAAAGCGATTGGGTCCTGGCCGCGCCCGG
TGTCTCGCGCACGCATGCGGTGGTGCGCTTCCTCAACGGGATGTATTTCATCGAAGACCGCAGCACCAAC
GGCATGTCGCTCAACGGCACTGCGCTGACGCGTGCGGACCCGTCCGCGCTCAGCGATGGCGACCGCCTGC
AGCTGGACAGCTTCGAGATCCAGGTGCAGGTGCAATCGCTGGCCGCAGCATCGCCGGCAACACCGGTGTT
CGACCCGCTGCCAGATGCGATGGACGACCGCACCCAGGTTGCGCCACCGCCGTCGACGCTGCGTGCCCCC
TCCGCCACAGCGGGCTTCGAGCTGCTGGAGTTCGGCACGCCGCCTGCGGCGCGGCCTGCGGTGGACGCAG
TGTTGGACGAATTGCTGCTGAGCGGCGCATCCCGCGAGCTGGATCCGTTGCGCCTGCTCGACCCGTTGCC
TGCGCCGGCGCGCGATGCCAGCCCCAGCGCGTGGAATCAGAGCAACGCCCGCCACGACCATTTCCGTCCG
CCGGCCAGTCCCGATGCACGTGCCACCTTGCCGGAAAACTGGGACATGACGCTTGGCGATTTTGCGCCAC
CCGCGCCATTGCCTGCGGTATCGCCCATGGCCGCGCCGGTGGTTTCGCCATTCACGTCGCCGGCGGCGCC
GGTTGCAGCCGCAGCATCGGCGGCAACGACGGTGCCGCCGGAGCTGGATCGCATCTTCGCCATCGTGGTC
GACGGCGTCATGGACGTGCTGCGTGCACGCGCGGAGATCAAGAACACCTTCCGGCTGCCGGTCACGGTGA
TCCAGCGCTCGGAGAACAATCCGCTCAAGTTCGCCGCCACCGCCGAAGATGCGCTGCAGAAGTTGCTCGC
ACCGCCAAGCGCGTCGTTTCTGTCCGGCGTGCCAGCGTTCGAAGATGCCTTCGACGATATCCGCTGCCAT
CAGATGGCGATGCTGGCCGGCATGCGCGCAGCCTTCGACGCCATGCTGTTCCACTTCAGCCCGGACCGCC
TGGAGCAGGAAGCCGACGCCGGCGGCAAGCGCCTGAGTTTCGGTGGCAAGGGGCGTTACTGGGAGCGTTA
CCGCGACAACTTCGAGCAGCTACGCAGCGACCCGGACGAATGCTTCCGTCGCCTGTTCGGCGATGAGTTC
GCGCGTGCCTACGAAGCGCAACTGGCGCGCCTGAAATCGGCACGGCGGCAGCCGGCGGGGCGCGGGATCT
AG