SecReT6
Protein ID: 78049773
SecReT6 ID102
T6SS typeN/A
Gene symbol-
Locus tagXCV4217
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T6SS(s) in this replicon]
Location [Strand]4841198..4843165 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ3BMR5
KEGG IDxcv:XCV4217
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.90E-71, Aligned region: 24..329
Phage_base_V [PF04717], Evalue: 7.90E-24, Aligned region: 50..64
Phage_base_V [PF04717], Evalue: 7.90E-24, Aligned region: 367..459
Protein Sequence: 655 a.a.     [Download]
>gi|78049773|ref|YP_365948.1| hypothetical protein XCV4217 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MPRTITLHSDLGERLLLHRMQASEALGQLFDYRIDALCTELQPNLRDLLGTPVAVQLADGEGEQRWYHGM
VASCAHNGYAVVDALDYAVLELQVVPKPWLLTQRRDCRIYQDMSVPEIVTSVLGEIGYGDVQQQLSAQYA
KRTYCVQYREDDFSFISRLLEREGIYYYFTHTRSAHTLVLADALGAHATKNGVDSLPYVPPGTDDRRLMR
SVVSHWRSARGVHSSQHGSTDYDPLQPRASLAADADAGGEQLHTVDGLIAFDYPGAHTVQADGRRYMQVR
TEAHNVQRASHAATTNACGLMVGALFRLRGFPRAELNQEYLVLSAHTTLAAPEHGSGEPPFSSSVQVMES
RLPFRSLQRTATPTIAGLQTAVVTGDTDEDIAVDAHGRVQVTFHWATAARPHAAPSCWVRVASMWAGKGW
GAMSLPRVGQEVVVSFLEGDPDRPLIVGSVYNGDHAPPFSLPDNKTQSGVRSRSLLGGAADFNELRFDDK
AGAEELYLRAQRDLREEVQHDHTSTIDNDRVLAVKHDRRARIDNNDSVEVGKKLLLKAGEEIELVTGSAR
LVMKHNGEIVLSGIKILVDASSEAKITSTAIKLLANAQLQAKSPATEVAGDATLKLTSGGMLSAEAGASA
TLKGPLVSIKADALVQVGGGLIMIG
 
Nucleotide Sequence: 1968 bp     [Download]
>gi|78045556|ref|NC_007508.1|:c4843165-4841198 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGCCGCGCACCATCACGCTGCACTCCGACCTTGGCGAGCGCCTGCTGCTGCATCGCATGCAGGCCAGCG
AAGCGTTGGGGCAGCTGTTCGACTACCGCATCGATGCGTTGTGCACCGAACTGCAGCCCAACCTGCGTGA
TCTGCTTGGCACGCCAGTGGCGGTGCAGCTGGCCGATGGCGAGGGCGAACAGCGCTGGTATCACGGCATG
GTGGCCAGTTGCGCGCACAACGGCTACGCCGTGGTCGATGCGCTCGATTACGCCGTGCTTGAACTGCAGG
TGGTGCCCAAACCATGGCTGCTGACCCAGCGCCGCGATTGCCGCATCTATCAGGACATGAGCGTGCCGGA
GATCGTCACCAGCGTGCTGGGCGAGATCGGCTACGGCGATGTGCAGCAGCAGTTGAGCGCGCAGTACGCC
AAGCGCACCTACTGCGTGCAATACCGCGAGGACGATTTCAGCTTCATCAGCCGGCTGCTGGAACGCGAAG
GCATCTACTACTACTTCACCCACACCCGCAGTGCGCATACGTTGGTGCTGGCCGATGCACTGGGTGCGCA
TGCAACGAAAAACGGCGTGGACAGCCTGCCCTATGTGCCGCCGGGAACCGATGACCGGCGCCTGATGCGC
TCGGTGGTGAGCCATTGGCGCAGTGCGCGCGGCGTGCATTCCAGCCAGCATGGCAGCACCGACTACGACC
CGCTGCAGCCGCGTGCATCGCTGGCCGCCGATGCCGATGCCGGCGGCGAACAGTTGCACACCGTCGATGG
TCTGATCGCCTTCGACTACCCCGGCGCGCATACCGTGCAGGCCGACGGTCGTCGCTACATGCAGGTGCGC
ACCGAGGCGCACAACGTGCAGCGCGCCAGCCATGCAGCCACCACCAATGCCTGCGGCCTGATGGTCGGTG
CCTTGTTTCGCTTGCGCGGGTTCCCGCGCGCCGAACTCAATCAGGAATATCTGGTGCTGTCGGCGCACAC
CACGCTGGCCGCGCCCGAACACGGCAGCGGCGAGCCGCCGTTTTCCAGCAGCGTGCAGGTGATGGAAAGC
CGGCTGCCGTTCCGTAGCCTGCAACGCACCGCAACGCCAACCATTGCCGGCCTGCAGACGGCGGTGGTGA
CCGGCGACACCGACGAGGACATTGCGGTGGATGCGCATGGCCGCGTGCAGGTGACCTTTCACTGGGCCAC
TGCGGCACGCCCGCATGCCGCGCCGTCGTGCTGGGTGCGTGTGGCTTCGATGTGGGCGGGCAAGGGCTGG
GGCGCAATGAGCCTGCCGCGCGTGGGGCAGGAAGTGGTGGTGAGCTTTCTGGAAGGCGACCCGGACCGCC
CGTTGATCGTGGGCAGCGTCTACAACGGCGACCATGCGCCGCCGTTTTCCTTGCCCGATAACAAGACCCA
AAGCGGCGTGCGCAGCCGCAGCCTGCTGGGCGGCGCTGCCGATTTCAACGAGTTGCGTTTCGACGACAAG
GCCGGCGCGGAAGAACTCTACCTGCGCGCGCAGCGCGATTTGCGCGAAGAGGTGCAGCACGACCACACCA
GTACCATCGACAACGATCGGGTCCTGGCGGTCAAGCACGACCGTCGTGCGCGGATCGACAACAACGACAG
CGTGGAGGTCGGCAAGAAGCTGCTGCTGAAAGCCGGCGAAGAGATCGAGTTGGTGACCGGCAGCGCGCGG
CTGGTGATGAAACACAACGGCGAGATCGTGTTGAGCGGCATCAAGATCCTGGTCGATGCCAGCTCGGAGG
CCAAGATCACCTCCACCGCCATCAAGCTGTTGGCCAATGCACAGCTGCAGGCCAAATCGCCGGCCACCGA
GGTGGCTGGCGATGCCACGCTCAAACTGACCTCCGGCGGCATGCTCAGCGCCGAAGCCGGTGCCTCGGCC
ACGCTCAAGGGCCCGCTGGTCAGCATCAAGGCCGACGCCTTGGTGCAGGTCGGCGGCGGCCTGATCATGA
TCGGATGA