SecReT6
Protein ID: 78049793
SecReT6 ID103
T6SS typei3
Gene symbol-
Locus tagXCV4237
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T6SS(s) in this replicon]
Location [Strand]4866154..4867194 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ3BMP5
KEGG IDxcv:XCV4237
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.40E-104, Aligned region: 25..329
Protein Sequence: 346 a.a.     [Download]
>gi|78049793|ref|YP_365968.1| hypothetical protein XCV4237 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MASPARHAPTPVSAAAAALAQALQTRPQDFSPFAALRAIERCHPLQPRLGESTRASDDVLRLRHAPSLAF
APHALDRYTPATHDQPAALYGLFLGLFGPNAPLPLHLTEYAIERAQQAKDGTFAAFADVFHHRMLSLFYR
AWAQAQPSVQAERPASDQFRAWLDALVGIASPHLRDRDALPDDARRYYAGRLGTATRTPEGLRALLQQLF
EWPVQVQEFIAEWMRLPADAHLQLGLGPRNARLGVDSVVGAHVRGAQQRVRICLGPLPRLAFQRFLPGGQ
ALRQLTAAVRSYLGDEFGWELQLLLKADEVPTPHLARNSRLGLDTWLGRRAWSIADADEVLLRPSG
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|78045556|ref|NC_007508.1|:c4867194-4866154 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGGCTAGCCCAGCCCGGCACGCGCCCACGCCTGTGAGCGCCGCGGCTGCGGCGCTGGCCCAGGCGCTGC
AGACCCGGCCACAGGATTTCAGCCCGTTCGCGGCCTTGCGCGCGATCGAGCGCTGCCATCCGCTGCAGCC
ACGCCTGGGTGAATCGACGCGCGCCAGCGACGATGTGCTGCGGCTGCGGCATGCGCCATCACTGGCATTC
GCACCCCATGCGCTGGACCGCTACACACCGGCAACGCACGATCAGCCTGCCGCGCTGTACGGTCTGTTTT
TAGGCCTGTTCGGCCCGAATGCGCCGTTGCCGTTGCACCTGACCGAATACGCCATCGAGCGTGCGCAGCA
AGCCAAGGACGGCACCTTTGCCGCATTTGCCGATGTGTTCCACCACCGCATGCTCAGCCTGTTCTACCGC
GCCTGGGCGCAGGCACAGCCCAGCGTGCAGGCCGAGCGCCCGGCGAGCGACCAGTTCCGTGCCTGGCTGG
ATGCACTGGTCGGCATCGCCAGCCCGCATCTGCGCGACCGCGACGCGTTGCCGGACGATGCACGTCGTTA
CTACGCCGGCCGTCTTGGTACCGCCACGCGCACGCCGGAAGGCTTGCGTGCCCTGCTGCAGCAGTTGTTC
GAATGGCCGGTGCAGGTACAGGAATTCATCGCCGAATGGATGCGCCTGCCGGCCGATGCGCACCTGCAAC
TTGGTCTGGGTCCGCGCAACGCGCGGCTGGGCGTGGACAGCGTGGTGGGCGCACACGTGCGTGGCGCCCA
GCAACGCGTGCGCATCTGCCTGGGGCCGCTGCCGCGCCTGGCATTTCAACGCTTTCTTCCGGGCGGCCAG
GCGCTCAGGCAACTCACCGCTGCGGTGCGCAGCTATCTGGGCGACGAATTTGGCTGGGAACTGCAGCTGT
TGCTCAAGGCTGATGAGGTCCCCACGCCGCACCTTGCGCGCAATAGCCGGCTGGGCCTGGACACCTGGCT
CGGCCGCCGCGCCTGGAGCATTGCCGACGCCGACGAGGTGCTGCTGCGCCCATCGGGCTGA