SecReT6
Protein ID: 78049794
SecReT6 ID103
T6SS typei3
Gene symbol-
Locus tagXCV4238
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T6SS(s) in this replicon]
Location [Strand]4867158..4869068 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ3BMP4
KEGG IDxcv:XCV4238
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.40E-220, Aligned region: 14..634
Protein Sequence: 636 a.a.     [Download]
>gi|78049794|ref|YP_365969.1| hypothetical protein XCV4238 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MSSKGTVDAMDPRLLPYYTRELQHVRDMGAEFAREYPKIAGRLGLDAFECADPYVERLLEGFAFLAARVQ
LKLDAQYPVFTQHLLEMVYPHYLAPLPSMAVVQLQPDLKDSGLAAGVVVPRQSALRSLVGPGERTACEFR
TAHAVSLWPLQLAEVKYLESPAALAAAGIALPAGRVVRAGVRLRFELVGGAQTQALALDRLPLFLAGADG
LPKRLYEQLHADTTAVVVRGSNASGGMLEMTLGADTVQMRGFAGDDALIPYDGRSFSGYRLLQEYFACPE
RFLFAELTGLRASLRRLHGSSFEVVVLLQRSLPSLAAAVGAEHFKLFCTPAINLFPRRADRIHLHAGLHE
YHVLADRTRPMDFEIHHLGEVEGFGDRQEPEQRFAPFYGGDARTWHARHGAFYSMRREPRMLSARQRRDG
ARSSYVGSEVFVSLVDADDQPHRTRLRQLGLQLWCSNRDLPLHMPVGKGTTDFTMDSGVPVQSVRCVAGP
TKPRPALSDGQTAWRLLSQLQLNYLSLFEDGPDGAAALREILTLYCDPFDASAQRQIEGVKQVSGTPIVR
RIPVPGPITFGRGLEITLTCEDAAFEGTGAFLLASVLRHFFARYVSVNSFTETVLRTTERNEVARWLAQP
GTRPRL
 
Nucleotide Sequence: 1911 bp     [Download]
>gi|78045556|ref|NC_007508.1|:c4869068-4867158 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGTCGTCGAAGGGCACGGTTGACGCCATGGACCCGCGCCTGCTGCCGTACTACACCCGCGAATTGCAGC
ACGTGCGCGACATGGGCGCGGAGTTCGCGCGCGAGTATCCCAAGATCGCCGGACGGCTCGGTCTGGACGC
GTTCGAATGTGCCGACCCGTATGTCGAGCGGTTGCTGGAAGGCTTCGCGTTCCTGGCCGCGCGCGTGCAA
CTCAAGCTGGACGCGCAGTACCCCGTGTTCACCCAGCACCTGCTGGAGATGGTCTACCCGCATTATCTGG
CGCCGCTGCCGTCGATGGCGGTGGTGCAGTTGCAGCCGGATCTGAAAGACAGCGGGCTGGCAGCAGGCGT
GGTGGTGCCGCGGCAAAGTGCGCTGCGCAGCCTGGTCGGCCCGGGCGAGCGCACCGCCTGCGAATTTCGC
ACCGCGCATGCAGTGAGCTTGTGGCCGTTGCAGCTGGCCGAGGTCAAGTATCTTGAATCGCCGGCCGCGT
TGGCGGCTGCCGGCATCGCCTTGCCGGCCGGGCGCGTGGTGCGTGCCGGCGTGCGTCTGCGCTTTGAGCT
GGTGGGTGGTGCGCAGACGCAAGCGCTGGCGCTGGATCGGCTGCCGCTATTCCTGGCCGGCGCCGACGGC
TTGCCCAAGCGGTTGTACGAACAGCTGCATGCCGATACCACCGCCGTGGTGGTGCGTGGCAGTAATGCCA
GCGGTGGCATGCTGGAGATGACGCTGGGCGCCGATACCGTGCAGATGCGCGGCTTTGCCGGCGACGATGC
ATTGATTCCGTACGACGGCCGTTCGTTCAGTGGTTACCGCCTGCTGCAGGAATACTTCGCCTGTCCGGAG
CGCTTTCTGTTCGCAGAACTCACCGGGCTGCGCGCGTCATTGCGGCGGTTGCACGGCAGCAGCTTCGAGG
TGGTGGTGTTGCTGCAACGCAGCCTGCCCAGCCTGGCTGCGGCAGTGGGCGCCGAGCATTTCAAATTGTT
CTGCACCCCGGCAATCAATCTGTTCCCGCGGCGTGCCGATCGCATCCATCTGCACGCCGGCCTGCACGAA
TACCACGTGCTGGCCGACCGCACCCGGCCGATGGATTTCGAGATCCATCATTTGGGCGAAGTGGAAGGCT
TCGGCGATCGTCAGGAGCCGGAGCAACGCTTCGCGCCGTTCTATGGTGGCGACGCACGCACTTGGCATGC
CCGGCATGGCGCGTTCTACAGCATGCGCCGCGAGCCGCGCATGCTATCGGCCCGCCAGCGCCGCGATGGC
GCGCGGTCGAGTTATGTGGGCAGCGAAGTGTTCGTCAGCCTGGTCGATGCCGACGATCAGCCGCACAGAA
CGCGCCTGCGCCAGCTTGGGCTGCAACTGTGGTGCAGCAACCGCGATCTGCCGCTGCATATGCCGGTAGG
CAAGGGCACCACCGATTTCACCATGGACAGCGGCGTGCCGGTGCAGAGCGTGCGCTGCGTGGCCGGGCCG
ACCAAGCCGCGCCCGGCGTTGTCGGATGGGCAGACTGCGTGGCGCCTGCTCAGCCAATTGCAGCTCAATT
ATCTCTCGCTCTTCGAAGACGGCCCCGACGGCGCCGCTGCGCTACGCGAGATCCTCACCTTGTACTGCGA
CCCGTTCGACGCATCCGCGCAGCGGCAGATCGAAGGCGTCAAGCAGGTGAGCGGCACACCGATCGTGCGG
CGTATCCCGGTGCCTGGCCCGATCACCTTCGGCCGCGGCCTGGAGATCACGCTGACCTGCGAGGACGCCG
CGTTCGAAGGCACCGGCGCCTTCCTGCTGGCTTCGGTGCTGCGGCACTTCTTCGCGCGCTATGTCTCGGT
GAATTCCTTCACCGAAACCGTGCTGCGCACCACCGAACGCAACGAGGTGGCCCGATGGCTAGCCCAGCCC
GGCACGCGCCCACGCCTGTGA