SecReT6
Protein ID: 78049795
SecReT6 ID103
T6SS typei3
Gene symbol-
Locus tagXCV4239
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T6SS(s) in this replicon]
Location [Strand]4869046..4869549 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ3BMP3
KEGG IDxcv:XCV4239
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.50E-21, Aligned region: 36..144
Protein Sequence: 167 a.a.     [Download]
>gi|78049795|ref|YP_365970.1| hypothetical protein XCV4239 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MAELTTTERLQPSLLDRLTDAAPSQREESREQRVISATRLRECVIRDLSWLLNAVNLETSRPLEAHPQVR
SSVLNYGIPDLAGVAVAGIDAAALQQRIREAILAFEPRLIPETLRVSVHADAARMDRRSLLFTIESEMWA
QPLPLNLYLKTALDLETGRLDVVEGHG
 
Nucleotide Sequence: 504 bp     [Download]
>gi|78045556|ref|NC_007508.1|:c4869549-4869046 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGGCCGAACTCACCACTACCGAACGCTTGCAGCCTTCGCTACTGGACCGGCTCACCGATGCCGCGCCCA
GCCAGCGCGAAGAGAGCCGCGAGCAACGCGTGATCTCGGCCACGCGCCTGCGCGAATGCGTGATCCGCGA
TCTGTCGTGGTTGCTCAATGCCGTAAATCTGGAAACCAGCCGCCCGCTGGAGGCGCACCCGCAGGTGCGC
AGCTCGGTGCTGAATTACGGCATCCCGGACCTGGCCGGTGTTGCAGTGGCCGGCATCGATGCGGCAGCGC
TGCAACAGCGCATCCGCGAGGCGATTCTGGCCTTCGAACCGCGGCTGATACCCGAGACGCTGCGCGTCAG
TGTGCATGCCGATGCCGCACGCATGGACCGGCGCTCGCTGCTGTTCACCATCGAATCGGAGATGTGGGCG
CAACCGCTGCCGTTGAATCTGTATCTGAAGACCGCGCTGGACCTGGAAACCGGGCGGCTCGATGTCGTCG
AAGGGCACGGTTGA