SecReT6
Protein ID: 78049796
SecReT6 ID103
T6SS typei3
Gene symbol-
Locus tagXCV4240
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T6SS(s) in this replicon]
Location [Strand]4869555..4870349 [-]
Producthypothetical protein
NoteTagJ
UniProt IDQ3BMP2
KEGG IDxcv:XCV4240
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 7.70E-43, Aligned region: 139..261
TPR_16 [PF13432], Evalue: 0.00026, Aligned region: 5..62
TPR_16 [PF13432], Evalue: 0.00026, Aligned region: 107..153
Protein Sequence: 264 a.a.     [Download]
>gi|78049796|ref|YP_365971.1| hypothetical protein XCV4240 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MDATAQTLLAQGEPAQALQQLIQQVRRQPADAAQRVFLFQLLAVLGQWSRAADQLRACAELDAATLPLVQ
TYLAVLQGEQTRAEVFAGARLPHVIGESAEWLAMHLHALQLSAQGRGEQAAALRTQAFELAPASAGVLDG
ERFQWLADADTRFGPCIELMLDSGYAWAPLSHIQQLRMQAPLDLRDTVWAPVSVLWRNGGQAFGYLPVRY
PGSEHLDAGELQLARRTEWTHGTQGEIGLGQRMWSTESHEIALLDVRDVQFDAD
 
Nucleotide Sequence: 795 bp     [Download]
>gi|78045556|ref|NC_007508.1|:c4870349-4869555 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGGATGCCACCGCACAGACCCTGCTGGCCCAAGGCGAGCCGGCGCAGGCGTTGCAGCAACTGATCCAGC
AGGTGCGCCGGCAACCGGCCGATGCAGCGCAGCGCGTGTTCCTGTTTCAGTTGCTGGCCGTCCTCGGGCA
GTGGTCGCGCGCCGCAGATCAGCTGCGCGCCTGCGCTGAACTGGATGCCGCCACGCTGCCCTTGGTGCAG
ACGTACCTTGCAGTGCTGCAGGGCGAACAGACGCGCGCCGAGGTGTTTGCCGGCGCGCGATTGCCGCATG
TGATCGGTGAGTCGGCCGAATGGTTGGCGATGCATCTACACGCGCTGCAACTGTCGGCGCAAGGGCGTGG
CGAACAAGCAGCTGCGTTGCGGACGCAAGCGTTCGAGTTGGCACCGGCTAGTGCCGGCGTGCTCGATGGC
GAACGCTTCCAGTGGCTCGCAGATGCCGATACCCGTTTCGGACCCTGCATCGAGCTCATGCTCGACAGCG
GCTACGCCTGGGCACCGCTCAGCCACATCCAGCAGTTACGCATGCAAGCGCCGCTGGATCTGCGCGACAC
CGTGTGGGCGCCGGTGAGCGTGCTATGGCGCAACGGCGGCCAGGCCTTCGGCTACCTGCCGGTGCGTTAC
CCCGGCAGCGAGCACCTGGATGCCGGCGAGCTGCAATTGGCGCGCCGCACCGAATGGACCCACGGCACGC
AGGGCGAAATCGGCCTGGGCCAGCGCATGTGGAGCACAGAGTCGCACGAGATTGCGCTGCTCGATGTGCG
TGACGTGCAGTTCGACGCGGACTGA