SecReT6
Protein ID: 78049797
SecReT6 ID103
T6SS typei3
Gene symbol-
Locus tagXCV4241
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T6SS(s) in this replicon]
Location [Strand]4870553..4871056 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ3BMP1
KEGG IDxcv:XCV4241
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.40E-33, Aligned region: 12..139
Protein Sequence: 167 a.a.     [Download]
>gi|78049797|ref|YP_365972.1| hypothetical protein XCV4241 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MAFDMHIKFGSGKVKIEGASNHKKHKGEIPILAWSWGASNSGDLHTGGGSASGGKAHIQDISITKYVDGC
SNALLDAVCTGARVENAWLYVTNATGEQSDFLTLELSEGVLITSLSTGGSGGEDRLTENVTLHFGKFKYG
FQPQDDKGAAQGGAKEFTYDIQGVAKA
 
Nucleotide Sequence: 504 bp     [Download]
>gi|78045556|ref|NC_007508.1|:c4871056-4870553 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGGCGTTCGACATGCACATCAAGTTCGGCAGCGGCAAGGTCAAGATCGAAGGCGCGTCCAACCACAAGA
AGCACAAGGGCGAAATTCCGATCCTGGCCTGGTCGTGGGGCGCGAGCAATTCCGGCGACCTGCACACCGG
TGGCGGCTCGGCCAGCGGTGGCAAGGCGCATATCCAGGACATCTCCATCACAAAGTACGTGGATGGTTGC
TCCAACGCATTGCTCGATGCGGTATGCACCGGGGCACGTGTGGAAAACGCCTGGCTGTACGTCACCAACG
CCACTGGCGAGCAGAGCGACTTTCTCACCCTGGAATTGAGCGAAGGCGTGCTGATTACCTCGTTGTCGAC
CGGCGGTTCCGGCGGCGAAGACCGCCTGACCGAAAACGTGACGCTGCACTTCGGCAAGTTCAAGTACGGC
TTCCAGCCGCAGGACGACAAGGGTGCCGCCCAGGGTGGCGCGAAGGAATTCACCTACGACATCCAGGGTG
TGGCCAAGGCCTAA