SecReT6
Protein ID: 78049798
SecReT6 ID103
T6SS typei3
Gene symbol-
Locus tagXCV4242
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T6SS(s) in this replicon]
Location [Strand]4871139..4872632 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ3BMP0
KEGG IDxcv:XCV4242
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.10E-194, Aligned region: 66..492
BMFP [PF04380], Evalue: 0.00029, Aligned region: 20..59
BMFP [PF04380], Evalue: 0.00029, Aligned region: 62..90
Protein Sequence: 497 a.a.     [Download]
>gi|78049798|ref|YP_365973.1| hypothetical protein XCV4242 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MSATEAALATSSTETTEQGDFAALLNREFRPKSERAKEEVESAVRTLAEQVLNRSDVVSEDVSQTIKAYI
AEIDRALTEQLNHILHHADLQQLEGAWRGLHYLVNNTETDQQLKIRVLNISKKELGKVLKRYKGTAWDQS
PIFKKVYEQEYGQLGGEPYGCLVGDYYFDQSPPDVELLNGMAQVAAAAHAPFIAAAAPKLMGMDNWSELS
NPRDLAKIFSTPDYAAWRSLRESEDSKYIGLAMPRTLSRLPYGAATSPVDEFDFEEDTAGADSSKYTWQN
AAYAMAVNINRSFKQYGWCSRIRGIESGGAVEGLPTHTFPTDDGGVDMKCPTEVAITDRRSAELDKMGLM
PLVHRKNSDMAAFISAQSLNKPDEYDDPDATANAALGARLPYMFACCRFAHYLKCIVRDKIGSFSDREQM
QSWLTRWVTQYIDGDPSNSSEETKARKPLAAAEVVVEEVEGAPGYYSSKFFLKPHYQLEGLTVSLRLVSR
LPSAAKA
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|78045556|ref|NC_007508.1|:c4872632-4871139 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGTCCGCGACCGAAGCCGCACTGGCCACCAGTAGCACCGAAACAACCGAACAGGGCGACTTTGCCGCGC
TGCTCAATCGCGAGTTCCGCCCCAAGAGCGAGCGCGCCAAGGAAGAAGTGGAATCGGCCGTGCGCACGCT
GGCCGAGCAGGTGCTCAACCGCAGCGATGTGGTCAGCGAAGACGTGTCGCAGACCATCAAGGCCTATATC
GCCGAGATCGATCGCGCCCTCACCGAGCAGCTCAACCACATCCTGCATCACGCCGATCTGCAGCAGCTCG
AAGGCGCCTGGCGCGGCCTGCATTATCTGGTCAACAACACCGAGACCGACCAGCAGCTCAAGATCCGCGT
GCTGAACATCAGCAAGAAGGAACTGGGCAAGGTGCTCAAGCGCTACAAGGGCACCGCCTGGGACCAGAGC
CCCATCTTCAAGAAGGTCTACGAGCAGGAATACGGCCAGCTCGGTGGCGAACCGTATGGCTGCCTGGTCG
GCGATTACTATTTCGACCAAAGCCCGCCGGATGTGGAACTGCTCAACGGCATGGCGCAGGTGGCTGCTGC
CGCGCATGCACCGTTCATTGCCGCGGCCGCGCCCAAGTTGATGGGCATGGACAACTGGAGCGAGCTCTCC
AACCCGCGCGACCTGGCGAAGATTTTCTCCACGCCCGATTACGCCGCATGGCGCTCGCTGCGCGAATCGG
AAGATTCCAAGTACATCGGCCTGGCCATGCCGCGCACGCTGTCGCGTCTGCCTTACGGCGCGGCCACCAG
CCCGGTGGATGAATTCGATTTCGAAGAAGACACTGCCGGCGCTGACTCGTCCAAGTACACCTGGCAGAAC
GCTGCCTATGCGATGGCAGTGAACATCAATCGCTCGTTCAAGCAGTACGGCTGGTGCTCGCGCATTCGCG
GTATCGAATCCGGCGGCGCAGTGGAAGGCTTGCCCACCCACACCTTTCCCACCGACGACGGTGGCGTGGA
CATGAAGTGCCCGACCGAAGTGGCGATCACCGACCGCCGCTCTGCCGAATTGGACAAGATGGGCCTGATG
CCGCTGGTGCATCGCAAGAACTCGGACATGGCCGCCTTCATCAGCGCGCAGTCGCTCAACAAGCCCGACG
AATACGACGACCCGGATGCCACCGCCAACGCAGCGTTGGGCGCGCGCTTGCCGTACATGTTCGCGTGCTG
CCGCTTTGCGCATTACCTCAAGTGCATCGTGCGCGACAAGATCGGTTCGTTCTCCGATCGCGAACAGATG
CAGAGCTGGCTGACGCGTTGGGTCACCCAGTACATCGACGGCGACCCGTCCAACTCAAGCGAAGAAACCA
AGGCGCGCAAGCCGCTGGCTGCCGCCGAGGTGGTGGTGGAAGAAGTGGAAGGCGCGCCGGGCTATTACAG
CTCCAAGTTCTTCCTCAAGCCGCATTACCAGCTGGAGGGCCTGACCGTGTCGTTGCGGTTGGTCTCGCGC
CTTCCCTCGGCCGCCAAGGCCTGA