SecReT6
Protein ID: 78049799
SecReT6 ID103
T6SS typei3
Gene symbol-
Locus tagXCV4243
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T6SS(s) in this replicon]
Location [Strand]4872637..4873146 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ3BMN9
KEGG IDxcv:XCV4243
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.60E-59, Aligned region: 8..161
Protein Sequence: 169 a.a.     [Download]
>gi|78049799|ref|YP_365974.1| hypothetical protein XCV4243 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MASSQKFIARNRAPRVQIEYDVEVYGAQKKVQIPFVMGVMSDLSGANAGELPSLDERKALEIDVDNFDSR
LQSMRPRAQFKVPNTLTGEGELAVDITFESMDDFSPAAIARKVAPLAKLLEARTQLANLDTYMDGKAGAE
QLIANAIRDPALLQSLVSAAKPASEPEGA
 
Nucleotide Sequence: 510 bp     [Download]
>gi|78045556|ref|NC_007508.1|:c4873146-4872637 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGGCCAGCAGTCAGAAGTTCATTGCCCGCAATCGGGCGCCACGGGTGCAGATCGAATACGACGTGGAGG
TCTACGGCGCGCAGAAGAAGGTGCAGATTCCGTTCGTGATGGGGGTGATGTCCGATCTGTCCGGCGCCAA
TGCCGGTGAGCTGCCCTCGCTGGATGAGCGCAAGGCACTGGAGATCGACGTCGACAACTTCGACAGCCGC
CTGCAGTCGATGCGGCCGCGCGCGCAGTTCAAGGTGCCCAACACGCTCACCGGCGAAGGCGAGCTGGCGG
TGGATATCACCTTCGAAAGCATGGACGACTTTTCGCCGGCCGCCATCGCGCGCAAGGTTGCGCCGCTGGC
GAAGTTGCTGGAAGCGCGCACGCAGCTGGCCAACCTGGACACCTACATGGACGGCAAGGCCGGTGCAGAG
CAGCTGATTGCCAACGCCATCCGCGACCCGGCGTTGCTGCAGTCGCTGGTGTCGGCCGCCAAGCCTGCCT
CCGAACCGGAAGGAGCCTGA