SecReT6
Protein ID: 78061823
SecReT6 ID105
T6SS typei3
Gene symbol-
Locus tagBcep18194_B0973
StrainBurkholderia sp. 383
Repliconchromosome 2 [GenBank: NC_007511] [Browse all T6SS(s) in this replicon]
Location [Strand]1087349..1088467 [-]
ProductImpA-like protein
NoteTssA
UniProt IDQ398M4
KEGG IDbur:Bcep18194_B0973
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.90E-20, Aligned region: 71..131
ImpA-rel_N [PF06812], Evalue: 3.90E-20, Aligned region: 221..237
Protein Sequence: 372 a.a.     [Download]
>gi|78061823|ref|YP_371731.1| ImpA-like protein [Burkholderia sp. 383]
MSKKSSPASNKPVRSPVADTPHDDWLAPLNGTEPCGPDLEYDHDFVVLFAGSAPRPDVQYGTFVGSPEPL
NWSETERDCRRLMTRTKDIRVAVLHTRCRTRLGGVAGLWEGMRLLAAWLQAFPEQVHPQADADNDRHAAL
EMRMNALQALSDPEGLLADVREIVLMRSTATRLQVRDVERAFAHPRPVDALAPDSVILQLQNLREQQPST
MKAFDDAISSLSAIDSWCSTHLETYLPDFSPLIRLLKLFQASDSLDETRPDTLPAAKYEDRDTDAPSVLA
EAVPSPVLPDSESAVSPDSPSIVARPDHVPMDRQAALTLIYTARRWFETNEPSSPIPVLLRRAEQFVGKR
YVDVVRAIPAELLTQWEEADGA
 
Nucleotide Sequence: 1119 bp     [Download]
>gi|78060853|ref|NC_007511.1|:c1088467-1087349 Burkholderia sp. 383 chromosome 2, complete sequence
ATGAGCAAAAAATCATCTCCCGCCTCAAACAAGCCTGTCCGTTCACCCGTCGCAGATACGCCGCATGACG
ACTGGCTGGCGCCGTTGAACGGTACCGAGCCGTGCGGCCCGGATCTCGAATACGACCACGATTTCGTGGT
GCTATTTGCCGGCAGCGCGCCTAGACCGGATGTGCAATACGGCACATTCGTCGGTTCGCCCGAACCGCTC
AACTGGAGCGAAACCGAGCGGGACTGCCGGCGGTTGATGACGCGCACGAAGGACATACGCGTTGCCGTGC
TGCATACGCGCTGTCGCACGCGCCTGGGCGGCGTGGCAGGCCTATGGGAAGGAATGCGGTTACTGGCGGC
GTGGTTGCAGGCATTTCCGGAGCAGGTCCATCCGCAGGCCGATGCCGACAACGATCGCCATGCAGCGCTC
GAAATGCGAATGAACGCGCTGCAAGCGCTGTCGGATCCGGAAGGGTTGCTGGCCGATGTGCGAGAGATCG
TACTGATGCGATCGACTGCCACCCGGTTGCAGGTTCGTGACGTCGAGCGCGCGTTCGCGCATCCGCGTCC
GGTCGATGCGCTCGCGCCCGATTCGGTCATCCTGCAATTGCAGAACCTGCGGGAACAGCAGCCGTCAACG
ATGAAGGCCTTCGACGACGCGATCTCGAGTCTCTCCGCTATCGATTCGTGGTGCTCGACGCACCTCGAGA
CGTACCTGCCGGATTTTTCCCCGTTGATCCGCCTGCTCAAGCTATTTCAAGCAAGCGATTCGCTGGACGA
AACCAGGCCTGACACTTTGCCCGCAGCCAAATACGAAGATCGCGACACGGATGCGCCGTCAGTGCTCGCC
GAAGCAGTGCCCTCGCCAGTACTTCCGGATAGCGAATCTGCTGTTTCGCCGGACTCGCCTTCCATTGTTG
CGCGCCCCGACCATGTACCGATGGACCGGCAAGCAGCGCTTACACTGATCTACACGGCACGCCGGTGGTT
CGAAACCAACGAACCAAGTAGCCCGATCCCGGTGCTGCTCAGGCGCGCGGAGCAATTCGTCGGAAAGCGC
TATGTTGATGTCGTCAGGGCCATTCCGGCGGAGCTTCTCACGCAGTGGGAAGAAGCAGACGGCGCATGA