SecReT6
Protein ID: 78061824
SecReT6 ID105
T6SS typei3
Gene symbol-
Locus tagBcep18194_B0974
StrainBurkholderia sp. 383
Repliconchromosome 2 [GenBank: NC_007511] [Browse all T6SS(s) in this replicon]
Location [Strand]1088464..1089519 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ398M3
KEGG IDbur:Bcep18194_B0974
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.50E-105, Aligned region: 18..319
Protein Sequence: 351 a.a.     [Download]
>gi|78061824|ref|YP_371732.1| hypothetical protein Bcep18194_B0974 [Burkholderia sp. 383]
MKRATLPTLSPELIEALQAEPWRFGFLSLLRRIGANPAVDPIGTARRPRAEPFRLGQQPSLAFPPREIAS
AHETAGRLKVRLFGLGMLGPNGPLPIHVTEIAKDRESSRRDTTTVDFFDIFHHRFFTLFYRAWASAQAAA
GLDRKHDEQFSFYIASLVGQAVGEIDRRPLPSHARLAASSHLVRESRNPDGLRTTLEHYFGVPVTLEENV
FHWIEIDPADCGRIGYPGAAATMGRGAVLGRVAPDRQHRFRIVIGPVDLDAYLRFTPQGEDLPRLVEWVR
AFVGHELEWELELRIKPESAPPAVMGGRQRMGWSGWLGRPAADKPITGMRFEPERHARHFNRRAPVSDHR
Q
 
Nucleotide Sequence: 1056 bp     [Download]
>gi|78060853|ref|NC_007511.1|:c1089519-1088464 Burkholderia sp. 383 chromosome 2, complete sequence
ATGAAGCGCGCCACACTACCCACGTTGTCGCCCGAATTGATCGAAGCCCTGCAGGCCGAACCCTGGCGCT
TCGGATTCCTGTCGTTGTTACGGCGGATCGGCGCGAACCCGGCGGTCGACCCGATCGGCACCGCACGCCG
GCCACGGGCCGAACCGTTCAGACTAGGCCAACAGCCGAGCCTGGCCTTCCCGCCGCGGGAAATCGCGAGC
GCACACGAGACGGCCGGGCGACTCAAGGTGCGGCTGTTCGGCCTCGGCATGCTGGGGCCCAACGGTCCAT
TGCCGATCCACGTTACCGAGATCGCGAAGGACCGGGAAAGCAGCCGCCGCGACACGACCACCGTCGACTT
CTTCGACATCTTCCATCACCGGTTCTTCACCCTGTTCTATCGGGCGTGGGCTTCGGCGCAAGCCGCTGCG
GGCCTCGACCGAAAACACGACGAGCAATTCTCGTTCTATATCGCAAGCCTCGTCGGGCAAGCGGTCGGCG
AAATCGACCGGCGCCCTCTTCCGTCGCATGCGCGCCTTGCCGCTTCGTCCCATCTCGTCCGCGAGTCGCG
TAATCCGGACGGGCTTCGCACCACGCTCGAACACTACTTCGGCGTTCCAGTCACCCTCGAGGAAAACGTC
TTTCACTGGATCGAAATCGATCCGGCCGACTGCGGGCGCATCGGATACCCGGGCGCTGCGGCCACGATGG
GCCGGGGCGCCGTGCTCGGGCGTGTCGCACCGGATCGTCAGCACCGGTTCCGCATCGTAATCGGCCCCGT
CGATCTGGATGCATACCTGCGCTTCACGCCGCAAGGCGAAGATCTGCCGCGACTCGTCGAGTGGGTTCGG
GCATTCGTCGGCCACGAGCTCGAGTGGGAACTGGAACTTCGCATCAAGCCCGAGAGCGCGCCGCCGGCCG
TCATGGGTGGCCGGCAACGCATGGGCTGGTCCGGCTGGCTGGGCCGCCCCGCCGCCGACAAGCCGATCAC
CGGCATGCGCTTCGAGCCGGAACGCCATGCACGCCATTTCAATCGTCGCGCCCCTGTCTCCGACCATCGA
CAATGA