SecReT6
Protein ID: 78061825
SecReT6 ID105
T6SS typei3
Gene symbol-
Locus tagBcep18194_B0975
StrainBurkholderia sp. 383
Repliconchromosome 2 [GenBank: NC_007511] [Browse all T6SS(s) in this replicon]
Location [Strand]1089519..1091408 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ398M2
KEGG IDbur:Bcep18194_B0975
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.00E-215, Aligned region: 5..628
Protein Sequence: 629 a.a.     [Download]
>gi|78061825|ref|YP_371733.1| hypothetical protein Bcep18194_B0975 [Burkholderia sp. 383]
MDPRLLDYYNQELIYMRELAAEFAHAHPKIARRLGMQTGEVADPYVERLIESFSFMAARMQIKLDAEFPR
FTERLLEVTYPNYVAPTPSISIARLYPGQAEGNLVNGYRLARGTSFTAKIPDGERTACQFTNGQDITLWP
LTITEARLTGIPPDIPALERYSPPDKQVRGALRIRLATTGNMRIADLKGLERLPVYLAGDEQVASHLFEL
LHAGGIASVIGAPGEFGTPGRSLAAVMETAIEHEGLGVDQSLLPLNWAKFHGHNLLHEYFACPARFWFFA
LNGLAEGFSRVNGREVEIVVLLDRAPGPLANLVDASRFALFCTPVINLFRKHTDRVEISPRDTEFHLVPA
RLTPLDYEVFSVRTVYGQVAATSSELEFRPLYQTLNNDEGNHGRYFSVRRERRLLSDSARRYGTRTPYVG
TEVFLSLVDQAEAPYGENIRFLSVEALLTNRDLATLVPRNGVHDLETAQSAPVDSIGLIRPPSAPLPPYA
EREMAWRLIRQLNFNYLPLEALDHREGGQGLRDLLRLYLVDGDSGQGRQVESLVGAKTRPVTRKLPGTGP
MTFGRGIECALTVDETGFSGVSPYLFGVILEHWLARHVSINSFTQTELHSMQRGRIARWPARTGTRGAL
 
Nucleotide Sequence: 1890 bp     [Download]
>gi|78060853|ref|NC_007511.1|:c1091408-1089519 Burkholderia sp. 383 chromosome 2, complete sequence
ATGGACCCGCGACTGCTCGACTACTACAACCAGGAACTCATTTACATGCGCGAGCTCGCCGCCGAGTTCG
CGCATGCCCATCCGAAAATCGCACGACGACTCGGCATGCAGACCGGCGAAGTGGCGGACCCTTATGTCGA
GCGTCTCATCGAATCGTTCAGCTTCATGGCTGCGCGCATGCAGATCAAGCTCGACGCTGAGTTTCCGCGC
TTCACGGAACGGCTACTCGAGGTCACCTATCCGAACTACGTCGCGCCGACCCCGTCGATCTCGATCGCTC
GCCTGTATCCCGGACAGGCAGAAGGCAACCTCGTCAATGGCTATCGCCTTGCTCGCGGGACCTCGTTCAC
CGCGAAGATTCCCGATGGAGAGCGCACGGCATGCCAGTTCACGAACGGGCAGGACATCACGCTGTGGCCG
CTCACGATCACCGAGGCACGGCTGACAGGCATTCCACCCGACATCCCGGCGCTGGAGCGCTATAGTCCGC
CCGACAAGCAAGTGCGCGGCGCGCTGCGGATCAGGCTCGCGACCACGGGGAACATGCGGATCGCCGACCT
GAAAGGACTCGAGCGGCTTCCGGTGTATCTGGCAGGCGACGAACAGGTCGCATCGCACCTGTTCGAGTTG
CTGCATGCGGGCGGAATTGCCTCCGTGATCGGTGCACCTGGAGAATTCGGCACACCTGGTCGCTCGCTCG
CGGCCGTCATGGAAACCGCGATCGAACACGAAGGACTGGGTGTCGATCAAAGCCTGTTGCCGCTCAACTG
GGCCAAGTTCCACGGGCACAACCTGCTGCATGAATACTTCGCGTGCCCCGCGCGGTTCTGGTTTTTTGCG
TTGAACGGCCTTGCCGAGGGCTTTTCGCGGGTCAATGGCAGAGAGGTCGAGATCGTCGTGCTGCTCGACC
GGGCGCCCGGGCCACTCGCCAATCTCGTCGATGCATCACGCTTCGCACTCTTCTGCACGCCCGTCATCAA
TCTGTTCCGCAAACATACCGACCGGGTCGAGATCTCGCCGCGCGACACCGAATTCCATCTGGTGCCGGCG
AGACTCACGCCACTCGACTACGAGGTGTTCTCGGTCCGCACCGTCTATGGGCAGGTGGCCGCGACGTCTT
CCGAACTCGAGTTCCGGCCGCTCTATCAGACGCTGAACAACGACGAAGGCAATCACGGTCGTTACTTTTC
GGTGCGGCGCGAGCGTCGCCTGCTGTCCGATTCGGCACGCCGCTACGGTACGCGCACGCCTTACGTCGGT
ACGGAGGTATTTCTCTCGCTCGTCGACCAGGCAGAGGCGCCGTACGGCGAAAACATTCGCTTCCTGTCGG
TCGAGGCACTGTTGACGAACCGGGATCTCGCCACACTCGTGCCGCGCAACGGCGTGCACGACCTGGAAAC
CGCACAGTCCGCGCCGGTCGACAGCATCGGCCTCATTCGCCCGCCGAGCGCACCGTTGCCGCCTTATGCC
GAGCGGGAAATGGCGTGGCGCCTGATCCGCCAGCTGAACTTCAACTATCTGCCGCTCGAAGCACTCGATC
ATCGGGAAGGCGGTCAAGGCCTGCGCGACCTGCTGCGTCTGTACCTCGTGGATGGCGACTCAGGGCAAGG
CCGTCAGGTCGAGAGCCTCGTGGGTGCGAAAACGCGCCCCGTCACGCGCAAGCTGCCGGGAACCGGCCCG
ATGACCTTCGGCCGCGGCATCGAATGTGCGCTGACGGTCGACGAGACAGGCTTCTCGGGCGTAAGTCCCT
ATCTCTTCGGGGTGATCCTCGAGCATTGGCTCGCGCGGCACGTCTCGATCAACAGCTTCACGCAGACGGA
GTTGCACTCGATGCAACGCGGCCGGATCGCGCGATGGCCGGCGCGCACGGGCACGCGCGGAGCGCTGTAA