SecReT6
Protein ID: 78061826
SecReT6 ID105
T6SS typei3
Gene symbol-
Locus tagBcep18194_B0976
StrainBurkholderia sp. 383
Repliconchromosome 2 [GenBank: NC_007511] [Browse all T6SS(s) in this replicon]
Location [Strand]1091446..1092018 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ398M1
KEGG IDbur:Bcep18194_B0976
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.60E-17, Aligned region: 51..168
Protein Sequence: 190 a.a.     [Download]
>gi|78061826|ref|YP_371734.1| hypothetical protein Bcep18194_B0976 [Burkholderia sp. 383]
MTEHRKRQPGADTPTARTPRRASSYLMPTLLDRLRDDAPHRQTEAPEEYTVTRKQMRDIVQRDLAYLLNT
TSIEDRIDRGRHPQAAASTVNFGVPPLAGTFIASRQWNDVEKMISRAIGDFEPRLIPDSLLISPRTTADA
DADSAGEHHNVLAFEVRGLIHMDPYPLEFMVQSSLDLETSEIRITGMRAG
 
Nucleotide Sequence: 573 bp     [Download]
>gi|78060853|ref|NC_007511.1|:c1092018-1091446 Burkholderia sp. 383 chromosome 2, complete sequence
ATGACTGAGCACCGGAAGCGCCAGCCGGGTGCCGACACCCCGACCGCACGTACGCCGCGACGGGCCAGTT
CGTATCTGATGCCGACGCTGCTCGATCGCCTGCGCGACGACGCACCGCATCGGCAGACCGAAGCCCCGGA
GGAATACACCGTCACGCGCAAGCAGATGCGCGACATAGTGCAGCGCGATCTCGCCTATCTGCTCAACACG
ACGAGTATCGAAGACCGGATCGATCGCGGCCGCCATCCGCAAGCAGCGGCATCGACAGTGAATTTCGGCG
TCCCGCCGCTTGCCGGCACGTTTATCGCATCACGCCAGTGGAACGATGTCGAAAAGATGATCAGCCGGGC
CATCGGCGATTTCGAACCGCGCCTGATCCCGGATTCGCTGCTGATATCACCCCGCACCACCGCCGATGCC
GATGCCGATTCCGCGGGTGAACATCACAACGTGCTCGCCTTCGAAGTCCGCGGCCTGATTCACATGGATC
CGTATCCGCTCGAATTCATGGTGCAAAGCTCGCTGGATCTCGAAACAAGCGAAATCCGCATCACGGGCAT
GCGCGCCGGCTGA