SecReT6
Protein ID: 78061827
SecReT6 ID105
T6SS typei3
Gene symbol-
Locus tagBcep18194_B0977
StrainBurkholderia sp. 383
Repliconchromosome 2 [GenBank: NC_007511] [Browse all T6SS(s) in this replicon]
Location [Strand]1092011..1092865 [-]
Productvirulence protein, SciE type
NoteTagJ
UniProt IDQ398M0
KEGG IDbur:Bcep18194_B0977
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 6.00E-52, Aligned region: 149..268
Protein Sequence: 284 a.a.     [Download]
>gi|78061827|ref|YP_371735.1| virulence protein, SciE type [Burkholderia sp. 383]
MTTLTATATPSAQRAGDLPLVDQIARIEANIRSQPTSASHRWALFQLMCLVGEWSRAIQQLQVWAQLEPA
QARTAQVYRDLIRAERWRAKVVEGRERPGAVLPSPPWIEAMLDAIRHAADGQVEQADTLRDTAFQAASDV
PLVAPLQGPAAWIADSDTRFGPVCEVITAGHYRWVPFADLAAWRVSQPAQPVDLVWAPCTLTYIDGSLVH
GFMPARYPGSETGSDAVRLGRETRWHDISRTGVVALGQKTWATDVGDFSLFELAHAEFGSRAAPAAIDAD
QSHD
 
Nucleotide Sequence: 855 bp     [Download]
>gi|78060853|ref|NC_007511.1|:c1092865-1092011 Burkholderia sp. 383 chromosome 2, complete sequence
ATGACCACACTCACCGCCACCGCTACGCCCTCCGCTCAACGTGCGGGCGACCTCCCGCTAGTCGACCAGA
TCGCACGTATCGAAGCGAACATCCGCTCGCAACCGACGAGCGCCTCCCATCGCTGGGCACTGTTCCAGTT
GATGTGCCTCGTGGGTGAATGGTCACGCGCCATTCAGCAACTGCAGGTTTGGGCGCAGCTTGAACCGGCT
CAGGCTCGAACCGCGCAGGTGTATCGCGATCTGATCCGTGCCGAACGGTGGCGGGCAAAGGTCGTCGAGG
GCCGGGAGCGACCCGGTGCCGTTCTTCCATCGCCGCCGTGGATCGAGGCGATGCTGGACGCGATCCGCCA
CGCGGCCGACGGGCAGGTCGAACAAGCCGACACCCTCCGCGATACGGCATTTCAGGCTGCATCCGACGTT
CCGCTCGTCGCGCCACTGCAGGGCCCTGCCGCATGGATTGCGGACAGCGACACCCGTTTCGGCCCGGTCT
GCGAAGTCATCACGGCCGGACACTATCGCTGGGTACCGTTCGCCGACCTGGCGGCATGGCGCGTGTCGCA
GCCGGCGCAACCGGTCGATCTGGTCTGGGCACCGTGCACACTCACCTACATCGACGGAAGCCTCGTCCAC
GGCTTCATGCCGGCCCGCTATCCGGGTTCGGAAACCGGCAGTGACGCCGTGCGCCTTGGGCGCGAAACCC
GCTGGCACGACATCAGCCGCACGGGTGTCGTCGCGCTCGGACAGAAAACCTGGGCAACCGACGTGGGCGA
CTTCAGCCTGTTCGAGCTGGCGCACGCCGAGTTCGGCTCGCGCGCTGCGCCTGCCGCGATCGACGCGGAT
CAATCCCATGACTGA