SecReT6
Protein ID: 78061829
SecReT6 ID105
T6SS typei3
Gene symbol-
Locus tagBcep18194_B0979
StrainBurkholderia sp. 383
Repliconchromosome 2 [GenBank: NC_007511] [Browse all T6SS(s) in this replicon]
Location [Strand]1094050..1096731 [+]
ProductATPase AAA
NoteTssH
UniProt IDQ398L8
KEGG IDbur:Bcep18194_B0979
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.00E-38, Aligned region: 230..309
AAA_2 [PF07724], Evalue: 1.00E-38, Aligned region: 611..777
AAA [PF00004], Evalue: 5.30E-21, Aligned region: 232..364
AAA [PF00004], Evalue: 5.30E-21, Aligned region: 616..700
AAA_5 [PF07728], Evalue: 1.30E-14, Aligned region: 232..310
AAA_5 [PF07728], Evalue: 1.30E-14, Aligned region: 334..362
AAA_5 [PF07728], Evalue: 1.30E-14, Aligned region: 615..733
ClpB_D2-small [PF10431], Evalue: 7.90E-14, Aligned region: 783..853
AAA_16 [PF13191], Evalue: 3.10E-09, Aligned region: 33..77
AAA_16 [PF13191], Evalue: 3.10E-09, Aligned region: 209..253
AAA_16 [PF13191], Evalue: 3.10E-09, Aligned region: 273..310
AAA_16 [PF13191], Evalue: 3.10E-09, Aligned region: 478..498
AAA_16 [PF13191], Evalue: 3.10E-09, Aligned region: 606..653
AAA_16 [PF13191], Evalue: 3.10E-09, Aligned region: 680..703
AAA_16 [PF13191], Evalue: 3.10E-09, Aligned region: 778..832
Sigma54_activat [PF00158], Evalue: 1.20E-08, Aligned region: 227..312
Sigma54_activat [PF00158], Evalue: 1.20E-08, Aligned region: 615..715
AAA_22 [PF13401], Evalue: 8.30E-08, Aligned region: 232..328
AAA_22 [PF13401], Evalue: 8.30E-08, Aligned region: 418..480
AAA_22 [PF13401], Evalue: 8.30E-08, Aligned region: 614..638
AAA_22 [PF13401], Evalue: 8.30E-08, Aligned region: 676..703
AAA_19 [PF13245], Evalue: 5.40E-07, Aligned region: 230..254
AAA_19 [PF13245], Evalue: 5.40E-07, Aligned region: 363..382
AAA_19 [PF13245], Evalue: 5.40E-07, Aligned region: 613..637
AAA_17 [PF13207], Evalue: 2.60E-06, Aligned region: 62..120
AAA_17 [PF13207], Evalue: 2.60E-06, Aligned region: 232..271
AAA_17 [PF13207], Evalue: 2.60E-06, Aligned region: 615..651
AAA_25 [PF13481], Evalue: 7.10E-06, Aligned region: 232..305
AAA_25 [PF13481], Evalue: 7.10E-06, Aligned region: 613..641
AAA_18 [PF13238], Evalue: 2.60E-05, Aligned region: 232..265
AAA_18 [PF13238], Evalue: 2.60E-05, Aligned region: 616..648
Clp_N [PF02861], Evalue: 2.70E-05, Aligned region: 26..74
Zeta_toxin [PF06414], Evalue: 2.80E-05, Aligned region: 232..256
Zeta_toxin [PF06414], Evalue: 2.80E-05, Aligned region: 608..655
NACHT [PF05729], Evalue: 4.30E-05, Aligned region: 232..259
NACHT [PF05729], Evalue: 4.30E-05, Aligned region: 615..642
AAA_29 [PF13555], Evalue: 5.80E-05, Aligned region: 224..254
AAA_29 [PF13555], Evalue: 5.80E-05, Aligned region: 613..640
IstB_IS21 [PF01695], Evalue: 0.00014, Aligned region: 224..288
IstB_IS21 [PF01695], Evalue: 0.00014, Aligned region: 615..635
IstB_IS21 [PF01695], Evalue: 0.00014, Aligned region: 686..713
AAA_14 [PF13173], Evalue: 0.00017, Aligned region: 232..313
AAA_14 [PF13173], Evalue: 0.00017, Aligned region: 614..697
AAA_30 [PF13604], Evalue: 0.0011, Aligned region: 221..254
AAA_30 [PF13604], Evalue: 0.0011, Aligned region: 614..645
T2SE [PF00437], Evalue: 0.0019, Aligned region: 220..252
T2SE [PF00437], Evalue: 0.0019, Aligned region: 613..685
TIP49 [PF06068], Evalue: 0.0021, Aligned region: 232..254
TIP49 [PF06068], Evalue: 0.0021, Aligned region: 285..312
TIP49 [PF06068], Evalue: 0.0021, Aligned region: 614..650
RNA_helicase [PF00910], Evalue: 0.003, Aligned region: 233..254
RNA_helicase [PF00910], Evalue: 0.003, Aligned region: 616..637
NTPase_1 [PF03266], Evalue: 0.0037, Aligned region: 232..257
NTPase_1 [PF03266], Evalue: 0.0037, Aligned region: 615..637
Arch_ATPase [PF01637], Evalue: 0.0062, Aligned region: 211..246
Arch_ATPase [PF01637], Evalue: 0.0062, Aligned region: 285..315
Arch_ATPase [PF01637], Evalue: 0.0062, Aligned region: 614..655
CbiA [PF01656], Evalue: 0.0075, Aligned region: 234..255
CbiA [PF01656], Evalue: 0.0075, Aligned region: 503..535
CbiA [PF01656], Evalue: 0.0075, Aligned region: 616..637
Protein Sequence: 893 a.a.     [Download]
>gi|78061829|ref|YP_371737.1| AAA ATPase, Clp [Burkholderia sp. 383]
MNISRQTLFGKLGVELYRGIESATSFCKLRGNPFVELVHWLHQLLQQPDGDLQRIVRHAHIDRDALERDL
ARALADLPAGASSISDFSWHVEAAIERGWVLSTLGHGDHRVRGAWLIAALVSTPELRRVLLAISPEFGKI
PVEGFGDVVPAWIAGSPEAADGAYDHSELEPALPGEASSAVSGTSKGNALEQYCLDLTALARAGEIDPVI
GRELEIRTMIDVLLRRRQNNPLVTGEAGVGKTAVVEGLARAIASGNVPPNLAEVRLLSLDVGALLAGASM
KGEFEARLKGVLEAAARSAVPVILFVDEIHTLIGAGGQAGTGDAANLLKPALARGTIRMIGATTWAEYKR
HIEKDPALTRRFQVLLVAEPSEAAATDMIRGLVPTFSSHHGVVVRDEAIRASVTLSHRYIPSRQLPDKAI
SLLDTACARVALSQHATPRELDDVRQRLAAARAEELLLVHEARIGIDADKALNRVRTRIDVLATEEAAIA
DRWREQVSAAQALLAGRDAAIAGTGDSPVSVDQLRKLERTLAKLQGDVPLVFPEVDESIVAEIVSDWTGI
PVGRMVIDEVAAVRRLPETLGARVIGQSEALHLIGERVQTARSGMTDPKKPLGVFLLAGPSGVGKTETAL
ALAEALYGGEQNLITINMSEYQESHTVSGLKGAPPGYVGYGEGGVLTEAVRRRPYAVVLLDEIEKAHRDV
HEMFFQVFDKGYMEDGDGRHIDFRNTTILLTSNVGAELSASLCADPALSPDFDHLRAALAPELLSAFPAA
FMGRVTVVPYRPLADDALASIVRLHLDRVVKRMADSHDIALAYDATVVNYIVGRCLVQETGARVLIGFIE
QHVLPRLSALWLDAFTSRAPLTRIAIGVADASASPAQALTFEATPSHPVEPCR
 
Nucleotide Sequence: 2682 bp     [Download]
>gi|78060853|ref|NC_007511.1|:1094050-1096731 Burkholderia sp. 383 chromosome 2, complete sequence
ATGAACATTTCACGCCAGACCTTGTTCGGCAAGCTCGGGGTCGAGCTTTACCGAGGAATCGAGTCGGCAA
CGAGTTTCTGCAAACTGCGCGGGAACCCGTTCGTCGAACTTGTCCATTGGCTGCATCAACTGCTCCAGCA
GCCGGACGGCGACCTGCAGCGGATCGTGCGCCATGCGCATATCGATCGCGATGCGCTCGAGCGCGATCTT
GCGCGGGCGCTGGCTGACTTGCCGGCAGGCGCGAGTTCGATCAGCGATTTCTCGTGGCATGTTGAAGCGG
CGATCGAACGTGGTTGGGTGCTGTCGACACTCGGGCATGGTGACCATCGTGTGCGCGGTGCATGGCTGAT
TGCGGCGCTTGTCTCGACCCCCGAACTGCGGCGCGTGCTGCTCGCGATTTCCCCGGAATTCGGCAAGATC
CCGGTGGAAGGCTTCGGCGATGTGGTGCCTGCCTGGATCGCTGGTTCGCCGGAGGCGGCCGACGGGGCGT
ACGATCACAGCGAACTCGAGCCGGCCTTGCCGGGCGAGGCATCCAGTGCCGTGTCGGGCACGTCGAAGGG
CAATGCACTCGAGCAGTATTGCCTGGATCTCACCGCTCTGGCCCGCGCAGGAGAAATCGATCCGGTCATC
GGCCGCGAACTCGAGATCCGCACCATGATCGACGTGTTGCTGCGCCGGCGGCAGAACAATCCGCTGGTTA
CCGGCGAGGCCGGCGTCGGCAAGACGGCTGTCGTGGAAGGGCTGGCGCGTGCGATTGCATCGGGCAACGT
GCCGCCGAATCTCGCGGAGGTACGCCTGCTGAGCCTCGATGTGGGCGCGCTTCTCGCAGGGGCGAGCATG
AAGGGCGAGTTCGAGGCTCGCCTGAAGGGGGTGCTCGAGGCTGCGGCAAGATCGGCGGTTCCCGTCATCC
TCTTTGTCGACGAAATTCATACGCTGATTGGCGCGGGTGGACAGGCCGGCACGGGTGATGCTGCCAACCT
CCTGAAACCGGCACTCGCGCGCGGTACGATCCGCATGATCGGTGCGACGACTTGGGCCGAATACAAGCGG
CATATCGAGAAGGATCCGGCGCTGACCCGGCGCTTTCAGGTATTGCTGGTCGCGGAGCCGTCCGAGGCGG
CTGCGACCGACATGATTCGCGGGCTCGTGCCGACGTTCTCGTCGCATCATGGCGTCGTTGTTCGGGACGA
AGCGATCCGGGCATCGGTGACGCTGTCGCATCGCTATATCCCGTCCCGTCAGTTGCCCGACAAGGCGATC
AGCCTGCTCGACACTGCATGCGCGCGTGTGGCGCTGTCGCAGCATGCGACGCCGCGCGAGCTGGATGACG
TGCGGCAGCGGCTGGCGGCCGCGCGCGCAGAAGAGTTGCTGTTGGTGCACGAGGCCCGTATCGGTATTGA
TGCGGACAAGGCGTTGAATCGCGTCCGCACGCGCATCGACGTGCTGGCGACGGAAGAAGCGGCAATCGCG
GATCGCTGGCGCGAGCAGGTGTCAGCCGCCCAGGCGTTGCTCGCCGGCAGAGATGCCGCGATCGCAGGCA
CAGGAGATTCACCGGTATCGGTCGATCAACTGCGCAAACTTGAACGTACGCTGGCCAAGCTGCAGGGCGA
TGTGCCGCTCGTCTTTCCCGAGGTCGACGAATCCATCGTCGCCGAAATCGTTTCGGACTGGACCGGAATC
CCGGTCGGCCGCATGGTCATCGACGAGGTCGCCGCCGTGCGTCGCTTGCCGGAAACGCTCGGCGCGCGCG
TGATCGGACAAAGCGAAGCGCTGCACCTGATCGGCGAGCGTGTACAGACTGCGCGGTCGGGTATGACCGA
TCCGAAGAAACCGCTGGGCGTATTCCTGCTGGCCGGCCCGTCCGGTGTCGGCAAGACCGAAACCGCGCTG
GCGCTTGCCGAAGCGCTGTACGGGGGCGAACAGAACCTGATCACGATCAACATGAGCGAGTATCAGGAGT
CGCACACGGTGTCGGGCCTGAAAGGTGCGCCGCCCGGCTATGTCGGCTACGGCGAGGGCGGTGTGCTGAC
CGAAGCGGTGCGCCGTCGCCCTTACGCGGTCGTGCTGCTCGACGAGATCGAGAAGGCGCATCGCGACGTA
CATGAAATGTTCTTCCAGGTGTTCGACAAGGGATACATGGAGGACGGCGATGGTCGCCATATCGATTTCC
GCAATACCACCATCCTGCTGACGAGCAACGTCGGTGCCGAACTGAGCGCGAGCCTGTGCGCGGATCCGGC
ACTGTCGCCCGATTTCGACCACCTGCGGGCCGCGCTAGCCCCGGAATTGCTGAGCGCATTTCCGGCGGCA
TTCATGGGGCGCGTGACGGTCGTGCCGTACCGGCCGCTTGCCGACGACGCGCTCGCCAGCATCGTTCGCC
TGCATCTGGATCGCGTCGTGAAACGCATGGCGGACAGCCACGACATCGCGCTTGCCTACGACGCCACGGT
CGTGAACTACATCGTCGGCCGTTGCCTGGTTCAGGAGACCGGTGCGCGCGTGCTCATCGGCTTCATCGAA
CAACACGTGCTGCCGCGCCTTTCCGCGCTCTGGCTTGACGCGTTCACATCGCGCGCGCCGCTCACACGCA
TCGCGATCGGCGTGGCCGATGCCTCCGCTTCGCCTGCCCAGGCGCTGACGTTCGAGGCGACCCCTTCTCA
TCCTGTCGAGCCGTGTCGTTGA