SecReT6
Protein ID: 78061830
SecReT6 ID105
T6SS typei3
Gene symbol-
Locus tagBcep18194_B0980
StrainBurkholderia sp. 383
Repliconchromosome 2 [GenBank: NC_007511] [Browse all T6SS(s) in this replicon]
Location [Strand]1096768..1097307 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ398L7
KEGG IDbur:Bcep18194_B0980
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.10E-60, Aligned region: 10..163
Protein Sequence: 179 a.a.     [Download]
>gi|78061830|ref|YP_371738.1| hypothetical protein Bcep18194_B0980 [Burkholderia sp. 383]
MSASSSQKFIARNRAPRVQIEYDVEVYGSEKKIELPFVMGVLADLSGKHPVEPLPAVSDRQFLEIDIDNF
DERMKAIRPRVAFAVPNTLTGEGQMMVDMTFESMEDFSPAAIADKVEPLRRLLQARTQLANLQTYMDGKS
GAEALVTQLLQDPALLKSLAAAPRPERREEGAADSSDAS
 
Nucleotide Sequence: 540 bp     [Download]
>gi|78060853|ref|NC_007511.1|:1096768-1097307 Burkholderia sp. 383 chromosome 2, complete sequence
ATGTCCGCTAGCAGTTCGCAGAAGTTCATCGCGCGCAATCGTGCGCCGCGCGTGCAGATCGAATACGACG
TTGAAGTGTATGGCTCGGAGAAGAAAATCGAGCTTCCGTTCGTGATGGGCGTACTCGCCGACCTGTCCGG
CAAGCATCCGGTCGAACCGCTGCCTGCGGTGTCGGATCGCCAGTTCCTGGAAATCGATATCGACAACTTC
GACGAGCGCATGAAGGCGATCCGGCCGCGCGTTGCGTTCGCCGTACCGAATACGCTGACGGGCGAAGGCC
AGATGATGGTCGACATGACCTTCGAAAGCATGGAGGACTTCTCGCCGGCCGCGATCGCCGACAAGGTGGA
GCCGCTGCGCCGCCTGCTTCAGGCGCGTACGCAACTGGCGAACCTGCAGACATACATGGACGGCAAGTCG
GGGGCAGAGGCGCTCGTCACCCAGTTGCTGCAGGACCCGGCCCTGCTGAAGTCGCTGGCCGCGGCGCCGC
GGCCCGAGCGGCGCGAAGAAGGCGCGGCCGATTCGAGCGACGCGAGCTGA