SecReT6
Protein ID: 78061831
SecReT6 ID105
T6SS typei3
Gene symbol-
Locus tagBcep18194_B0981
StrainBurkholderia sp. 383
Repliconchromosome 2 [GenBank: NC_007511] [Browse all T6SS(s) in this replicon]
Location [Strand]1097335..1098828 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ398L6
KEGG IDbur:Bcep18194_B0981
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.40E-194, Aligned region: 65..491
Protein Sequence: 497 a.a.     [Download]
>gi|78061831|ref|YP_371739.1| hypothetical protein Bcep18194_B0981 [Burkholderia sp. 383]
MAKQQAPAVEAQATTQSDFTQLLEREFRPKTDQARAAVEHAVQTLAEQALTQSITISDDAYKSIAAIIAQ
IDHKLSEQINLILHHDDYQALESAWRGLNHLVSNTETDEHLKIRVMDVSKAELHRSMRRYKGLAWDQSPL
FKQIYEQEYGQLGGEPYGCIVADYYFDHTPPDVDLLGSIAKVAAASHTPFVTGAAPSVLQMESWQELANP
RDLTKIFTQNLEYTAWNSLRNTEDARYVGLAMPRFLARLPYGAKTNPVDQFDFEEDTNGSNHSRYGWANA
AYAMGVNINRSFKQYGWCSLIRGVESGGTVENLPCHTFPTDDGGIDMKCPTEIAISDRREAELSKNGFIP
LVHRKNTDHATFIGAQSLQKPAEYHDPDATANANLSARLPYLFACSRFAHYLKCIVRDKIGAFKEREDMQ
RWLNEWIMHYVDADPANSSQDTKARRPLAAAEVLVEEVEGNPGYYQAKFFLRPHFQLEGLTVSLRLVTKL
PSIKEAA
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|78060853|ref|NC_007511.1|:1097335-1098828 Burkholderia sp. 383 chromosome 2, complete sequence
ATGGCAAAACAGCAAGCACCGGCCGTCGAGGCCCAGGCGACCACCCAGTCCGACTTTACGCAGCTGCTGG
AGCGGGAATTCCGGCCGAAGACGGACCAGGCCCGCGCGGCGGTCGAACATGCGGTGCAAACGCTTGCGGA
GCAGGCGCTCACGCAATCGATCACGATCAGCGACGACGCCTACAAGAGCATCGCGGCCATCATCGCGCAG
ATCGATCACAAGCTTTCCGAGCAGATCAACCTGATCCTGCATCACGACGACTACCAGGCGCTCGAATCCG
CGTGGCGCGGCCTGAACCACCTCGTGTCGAACACGGAGACGGACGAACACCTGAAGATCCGCGTGATGGA
CGTCTCGAAAGCCGAGCTGCATCGCTCGATGCGTCGCTACAAGGGTCTGGCGTGGGATCAGAGCCCGCTC
TTCAAGCAGATCTACGAGCAGGAATATGGCCAGCTCGGCGGCGAGCCGTACGGCTGCATCGTGGCCGACT
ACTACTTCGACCATACGCCGCCGGACGTCGACCTGCTCGGTTCGATCGCGAAGGTGGCAGCGGCTTCGCA
CACGCCGTTCGTGACCGGCGCGGCTCCGTCGGTGCTGCAGATGGAGTCCTGGCAGGAACTCGCCAACCCG
CGCGACCTGACCAAGATCTTCACGCAGAACCTCGAATACACCGCGTGGAATTCGCTGCGCAATACTGAGG
ATGCGCGCTACGTCGGTCTCGCGATGCCGCGCTTCCTGGCGCGCCTGCCGTATGGCGCGAAGACCAATCC
GGTCGACCAGTTCGATTTCGAGGAAGATACGAACGGCTCGAACCACAGCCGCTATGGCTGGGCCAACGCG
GCCTACGCGATGGGCGTCAACATCAACCGCTCGTTCAAGCAATACGGCTGGTGCTCGCTGATCCGCGGCG
TCGAATCGGGCGGTACGGTCGAGAACCTGCCGTGCCATACGTTCCCGACGGATGACGGCGGGATCGACAT
GAAGTGCCCGACCGAGATCGCGATTTCTGATCGTCGCGAGGCCGAGCTGTCGAAGAACGGCTTCATCCCG
CTCGTGCATCGCAAGAACACCGATCACGCGACCTTCATCGGCGCGCAGTCGCTGCAGAAGCCGGCCGAGT
ATCACGATCCCGACGCGACTGCCAACGCGAACCTGTCCGCGCGCCTGCCGTATCTGTTCGCGTGCTCGCG
CTTCGCGCATTACCTGAAGTGCATCGTGCGCGACAAGATCGGTGCATTCAAGGAGCGCGAGGACATGCAG
CGCTGGCTCAACGAATGGATCATGCATTACGTCGACGCCGACCCTGCGAACTCGTCGCAGGACACGAAGG
CGCGCCGGCCGCTCGCCGCTGCGGAAGTGCTCGTCGAGGAAGTGGAAGGCAATCCCGGCTATTACCAGGC
GAAGTTCTTCCTGCGCCCGCACTTCCAGCTCGAAGGGCTGACCGTTTCGCTGCGGCTCGTGACGAAGCTG
CCGTCGATCAAGGAAGCCGCTTAA