SecReT6
Protein ID: 78061833
SecReT6 ID105
T6SS typei3
Gene symbol-
Locus tagBcep18194_B0983
StrainBurkholderia sp. 383
Repliconchromosome 2 [GenBank: NC_007511] [Browse all T6SS(s) in this replicon]
Location [Strand]1099487..1099990 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ398L4
KEGG IDbur:Bcep18194_B0983
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.40E-44, Aligned region: 13..158
Protein Sequence: 167 a.a.     [Download]
>gi|78061833|ref|YP_371741.1| hypothetical protein Bcep18194_B0983 [Burkholderia sp. 383]
MRSILTAASLAGVVLLSACASGEPKPKEPVRLELAVKAASDVNPDDRGRAAPIVVRIYELKNDNAFEAAD
FFTLENQDKTVLADDVVKRDEFQLRPGEQRKVVRRPDPETTAIGVIAAYRDLPNAVWRSVYTMPASPDKA
WYRFTTKLKLIVDLEAKAVRIDEAKKK
 
Nucleotide Sequence: 504 bp     [Download]
>gi|78060853|ref|NC_007511.1|:1099487-1099990 Burkholderia sp. 383 chromosome 2, complete sequence
ATGCGTTCGATTCTGACTGCCGCGTCGCTCGCCGGCGTCGTGCTGCTCTCGGCCTGCGCGAGCGGCGAAC
CGAAGCCGAAGGAGCCGGTTCGGCTCGAACTGGCCGTCAAGGCGGCATCCGACGTCAATCCAGACGATCG
TGGCCGGGCGGCGCCGATCGTCGTGCGCATCTACGAGCTGAAGAACGACAACGCATTCGAGGCGGCGGAT
TTCTTCACGCTGGAGAATCAGGACAAGACGGTGCTGGCCGACGACGTCGTCAAGCGCGACGAGTTCCAGC
TGCGGCCCGGCGAGCAACGGAAAGTCGTCCGCCGACCGGATCCGGAAACGACTGCCATCGGCGTGATCGC
GGCCTATCGCGACCTGCCGAACGCGGTGTGGCGGTCGGTTTATACGATGCCGGCCTCGCCTGACAAGGCG
TGGTACCGCTTTACAACGAAGCTGAAACTGATTGTCGATCTTGAGGCCAAGGCCGTCAGGATCGACGAAG
CGAAGAAGAAATGA