SecReT6
Protein ID: 78061834
SecReT6 ID105
T6SS typei3
Gene symbol-
Locus tagBcep18194_B0984
StrainBurkholderia sp. 383
Repliconchromosome 2 [GenBank: NC_007511] [Browse all T6SS(s) in this replicon]
Location [Strand]1100022..1101368 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ398L3
KEGG IDbur:Bcep18194_B0984
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.00E-138, Aligned region: 20..447
Protein Sequence: 448 a.a.     [Download]
>gi|78061834|ref|YP_371742.1| hypothetical protein Bcep18194_B0984 [Burkholderia sp. 383]
MSWYAKVAWQEGLFFRPQLFQQQERYFEKYAHMRAAPLSPFFFGFAHYGLDLESLALGKVIVKAAAGVFA
DGTPFDAPGNTPLPPPLTIRQEHLDQVIYLAVPVRLPNCEETTFENKADSMARYQVFDTELRDSNSVGLA
PESVQLSNLRLRLVPEKELGDAWIGLALTCVKTIRADGSIELDDTIVPPVSGYGASDLLTSWVTKIHDLA
HLRANALSQRLAGTDDTTASAATVTDYLLLQILNRYEPLLQHMLSVPTTSPADVYTLLIAMAGELSTHLR
TDTRRPLDTHPPYQHTTPHLCLKPVVDDTHRLLNAVLVRSAQSIVLEDQGHGMRNAVVDPVDMQGFASLV
LAVHAAMPPDALRQQFLAQAKAGPSEKLPSLVRSHLPGVGMQLLPVPPRQIPFNAGYIYYELMQGGALWE
EVVRHGGVALHVAGEFPSLKLELWGVRA
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|78060853|ref|NC_007511.1|:1100022-1101368 Burkholderia sp. 383 chromosome 2, complete sequence
ATGAGCTGGTACGCCAAGGTCGCCTGGCAGGAAGGGTTGTTTTTCAGACCGCAACTGTTCCAGCAACAGG
AACGCTACTTCGAGAAGTACGCACACATGCGTGCGGCGCCGCTGTCGCCGTTTTTCTTCGGCTTCGCGCA
TTACGGGCTCGATCTTGAGTCGCTCGCACTCGGGAAGGTGATCGTCAAGGCGGCCGCCGGCGTGTTCGCC
GACGGCACGCCGTTCGATGCGCCGGGCAACACGCCGTTGCCGCCGCCGTTGACGATCCGTCAGGAACACC
TCGATCAGGTGATCTATCTGGCGGTTCCGGTGCGCTTGCCGAACTGCGAGGAAACCACCTTCGAGAACAA
GGCGGATTCGATGGCGCGCTACCAGGTGTTCGATACCGAACTGCGCGACTCGAATTCAGTCGGGCTGGCG
CCTGAATCCGTGCAGTTGTCGAACCTGAGGTTGCGCCTCGTGCCCGAGAAGGAGCTGGGCGATGCATGGA
TCGGCCTTGCGCTGACGTGTGTGAAGACCATCCGCGCGGACGGCAGCATCGAACTTGACGACACGATCGT
GCCGCCCGTGTCCGGCTATGGCGCGAGCGATCTGCTGACGAGCTGGGTCACGAAAATCCACGATCTCGCC
CACCTGCGTGCGAATGCGTTGTCGCAACGGCTGGCCGGTACCGATGACACAACCGCGAGTGCGGCGACGG
TCACGGATTATCTGTTGTTGCAGATACTGAATCGATACGAGCCGTTGCTGCAGCACATGCTGAGCGTGCC
GACCACGTCGCCTGCCGATGTGTACACGTTGCTGATCGCGATGGCTGGCGAGTTGTCGACCCATCTGCGT
ACAGACACGCGCCGCCCGCTCGATACGCATCCGCCATATCAGCATACGACGCCGCATCTCTGCCTGAAGC
CGGTGGTCGACGACACGCATCGGCTGCTCAACGCCGTACTGGTGCGGAGCGCGCAGAGCATCGTGCTCGA
GGACCAAGGCCACGGCATGCGCAATGCGGTGGTCGATCCGGTGGATATGCAGGGTTTTGCGTCGCTTGTG
CTGGCCGTTCATGCGGCGATGCCGCCCGATGCGCTGCGCCAGCAGTTTCTCGCGCAGGCAAAGGCGGGGC
CGTCGGAGAAGCTGCCGAGCCTGGTGCGCAGTCATCTGCCGGGTGTTGGCATGCAGCTCCTGCCGGTGCC
GCCGCGGCAGATTCCGTTCAACGCCGGATACATCTATTACGAGCTGATGCAGGGCGGGGCGCTGTGGGAG
GAGGTGGTGCGGCATGGCGGTGTTGCGCTGCACGTCGCGGGGGAGTTTCCGTCTCTCAAGCTCGAATTGT
GGGGCGTACGCGCATAA