SecReT6
Protein ID: 78061835
SecReT6 ID105
T6SS typei3
Gene symbol-
Locus tagBcep18194_B0985
StrainBurkholderia sp. 383
Repliconchromosome 2 [GenBank: NC_007511] [Browse all T6SS(s) in this replicon]
Location [Strand]1101550..1104081 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ398L2
KEGG IDbur:Bcep18194_B0985
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-68, Aligned region: 37..379
Phage_GPD [PF05954], Evalue: 1.50E-68, Aligned region: 645..645
DUF2345 [PF10106], Evalue: 9.20E-46, Aligned region: 663..813
T6SS_Vgr [PF13296], Evalue: 1.30E-34, Aligned region: 524..633
T6SS_Vgr [PF13296], Evalue: 1.30E-34, Aligned region: 697..728
Phage_base_V [PF04717], Evalue: 1.90E-17, Aligned region: 69..94
Phage_base_V [PF04717], Evalue: 1.90E-17, Aligned region: 262..310
Phage_base_V [PF04717], Evalue: 1.90E-17, Aligned region: 423..512
Protein Sequence: 843 a.a.     [Download]
>gi|78061835|ref|YP_371743.1| Rhs element Vgr protein [Burkholderia sp. 383]
MALLDVPRTLSVSGAALPMYGGQSILTPMKLTGGEIIGELFEYTLELKTPDSLGFSQSIAANVNLDALIG
TEVTVSIQLEGKGRFIPGLAGAAGMANVGAGMREITGVVSHATIVREDGRSIVYELTLRPWLWHATKNCD
CRIFQDMSVVEITDAVLSVYPFPVEKRLTTPRPNKVWPKRDIQRQHLESDWTFLQRLWEEWGIYYFFEHD
EGKHRLVLCDSMGALKPLSDAYAALRYDPPTSRRIDEEHIHEFSVSHALTKGAVTSVDYDYTLPRANLKV
TREDPRDTGLAHQEQYSWGDYAQPQAGAAGLSGDHNEPRTEAEYLTLVQMQAWRCQGLRAYGKGNLRGLV
TGQTFVLAHYPQDAANREYAVVGCMLTIEDIGEASGSGQRYRCEADFTLQPANEPFRLLRTIAKPRMTGV
EYAVVTCPENQEIWTDAYGRVKLQFLWDRLGNNDERSSCWVRVAGAWHGDQFGGIFLPRRGHEVEVAFVN
GDPDLPIIVGSASNAFNMPPFALPENQTLAGYRSREIGGRRANTLAFDDTNGKIQAHLSSDEGASQLNLG
YITRIAGNAGRQDERGRGAELRTDGHGVFRAGQGMLLTTEVRQDAQAHVTDMGETTARLEEAERWQTMIA
ELAQQATAQEANSHQEEVAKTLAKQNAVIGGSQGAAADGFSELGAPHVVIAGAAGIQTTTPATTHIASGQ
HVALTSGEHIAASANGSVLISAQDSVRQFAARGGMKSVAADGNIDIHALQKAINLLAMLEVNITSDTIHI
SAKKKLVLNGGGSYIELEQGSIKSGTSGVWLAHAANHYFPQPDEVPVELHVPKVCIECLLKAAKSGASAV
PRL
 
Nucleotide Sequence: 2532 bp     [Download]
>gi|78060853|ref|NC_007511.1|:1101550-1104081 Burkholderia sp. 383 chromosome 2, complete sequence
ATGGCTTTGCTTGATGTACCACGGACGTTGTCGGTTTCCGGCGCTGCGCTGCCGATGTACGGCGGACAGT
CGATCCTCACTCCGATGAAGCTGACCGGCGGCGAAATCATCGGAGAATTGTTCGAGTACACGCTCGAACT
GAAAACGCCGGATTCGCTCGGGTTTTCGCAGAGCATCGCTGCGAACGTCAATCTTGATGCGCTGATTGGC
ACGGAAGTGACCGTATCGATCCAGCTCGAGGGAAAAGGGCGTTTCATTCCGGGTCTAGCCGGTGCCGCCG
GAATGGCGAACGTCGGTGCTGGCATGCGCGAGATCACTGGTGTTGTAAGCCATGCGACGATCGTGCGTGA
AGACGGACGGTCGATCGTCTATGAGCTCACGCTCCGACCGTGGCTGTGGCACGCGACCAAGAACTGCGAT
TGCCGCATCTTCCAGGATATGTCCGTTGTCGAGATCACCGATGCGGTACTCTCGGTCTACCCGTTTCCGG
TCGAAAAACGACTCACGACTCCGCGGCCGAACAAGGTATGGCCCAAACGGGACATCCAGCGCCAACATCT
CGAAAGCGACTGGACATTCCTGCAGCGCTTGTGGGAAGAGTGGGGCATCTATTATTTCTTCGAGCACGAC
GAGGGCAAGCATCGTCTCGTGCTTTGCGACTCGATGGGGGCACTCAAACCGCTGAGTGATGCCTATGCCG
CACTTCGCTACGATCCGCCGACCAGTCGGCGGATTGATGAAGAGCACATTCACGAATTCTCGGTATCACA
TGCGCTGACCAAGGGCGCAGTGACGAGTGTCGACTACGACTACACGTTGCCGCGCGCAAATCTCAAGGTG
ACGCGCGAGGACCCCCGCGACACTGGGCTCGCCCATCAGGAGCAGTACTCATGGGGGGATTATGCGCAGC
CTCAAGCTGGCGCGGCTGGTCTTTCAGGCGACCACAACGAGCCGCGCACGGAGGCGGAGTATCTGACGCT
GGTGCAGATGCAGGCGTGGCGTTGCCAAGGCTTGAGGGCTTACGGTAAAGGTAACCTGCGCGGCCTCGTC
ACAGGTCAGACGTTTGTGCTGGCGCACTACCCGCAGGACGCGGCCAACCGAGAGTATGCAGTCGTCGGCT
GCATGCTGACGATTGAGGATATCGGCGAAGCGTCAGGTTCCGGTCAGCGTTATCGCTGCGAAGCGGATTT
CACGCTGCAGCCGGCCAACGAGCCATTCCGGCTGTTGCGAACTATCGCGAAGCCGCGCATGACCGGCGTC
GAATACGCCGTTGTGACGTGTCCCGAGAACCAGGAGATCTGGACCGATGCCTATGGTCGGGTGAAGCTGC
AGTTTCTGTGGGATCGGCTCGGCAATAACGACGAGCGTTCAAGTTGTTGGGTGCGAGTGGCCGGTGCATG
GCATGGCGATCAGTTCGGTGGAATCTTCCTGCCGCGTCGGGGACATGAGGTCGAAGTCGCTTTCGTCAAC
GGCGATCCTGACCTGCCGATCATCGTGGGCAGCGCGAGCAATGCGTTCAATATGCCGCCGTTCGCGTTGC
CGGAGAACCAGACGCTGGCCGGCTATCGCAGCCGGGAGATCGGCGGTCGTCGTGCGAACACGCTTGCCTT
CGACGATACGAACGGAAAAATTCAGGCGCATCTGTCGAGCGACGAAGGCGCGTCGCAGTTGAATTTGGGT
TACATCACGCGTATTGCGGGCAACGCAGGGCGGCAGGATGAGCGTGGTCGCGGGGCTGAACTGCGCACGG
ATGGTCATGGCGTATTTCGTGCCGGGCAGGGGATGCTGCTCACGACCGAAGTTCGGCAAGACGCGCAGGC
CCATGTGACCGACATGGGTGAAACGACGGCTCGACTCGAAGAGGCCGAGCGTTGGCAGACGATGATCGCG
GAACTGGCGCAGCAGGCGACGGCTCAAGAGGCGAACAGCCATCAGGAGGAAGTCGCCAAGACGCTCGCCA
AACAGAACGCTGTGATAGGCGGATCGCAAGGCGCTGCCGCCGATGGCTTTTCTGAACTCGGTGCGCCGCA
CGTCGTCATCGCCGGCGCTGCCGGTATCCAGACCACGACGCCAGCGACAACGCATATCGCAAGCGGTCAG
CACGTCGCACTGACGAGCGGGGAGCACATCGCGGCGTCGGCAAACGGCAGTGTCCTCATCAGCGCACAGG
ATTCAGTGCGCCAGTTTGCGGCACGTGGGGGCATGAAATCCGTCGCGGCAGACGGGAACATCGACATTCA
CGCGCTTCAGAAGGCGATCAATCTGCTGGCCATGCTCGAGGTCAACATAACCAGCGACACGATTCATATC
AGCGCGAAGAAGAAATTGGTGTTGAACGGGGGCGGCAGCTATATCGAGCTTGAACAGGGCAGTATCAAGA
GCGGGACGAGCGGCGTCTGGCTTGCCCATGCAGCCAATCACTATTTCCCTCAGCCAGACGAAGTGCCTGT
CGAGCTCCACGTTCCCAAGGTGTGTATCGAGTGCCTGCTGAAAGCCGCGAAGAGTGGCGCATCCGCTGTT
CCTCGGCTCTAA