SecReT6
Protein ID: 78061840
SecReT6 ID105
T6SS typei3
Gene symbol-
Locus tagBcep18194_B0990
StrainBurkholderia sp. 383
Repliconchromosome 2 [GenBank: NC_007511] [Browse all T6SS(s) in this replicon]
Location [Strand]1108534..1108815 [+]
Producthypothetical protein
NotePAAR
UniProt IDQ398K7
KEGG IDbur:Bcep18194_B0990
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.80E-21, Aligned region: 8..85
Protein Sequence: 93 a.a.     [Download]
>gi|78061840|ref|YP_371748.1| hypothetical protein Bcep18194_B0990 [Burkholderia sp. 383]
MSISIAVVGDATDHGGRIITGSDTHKIGGKKIARLHDLVDCPETYPDGRPHGINKIIEAHPTLSVGGRYV
ALHGHRTECGCRLIATSTAKVGR
 
Nucleotide Sequence: 282 bp     [Download]
>gi|78060853|ref|NC_007511.1|:1108534-1108815 Burkholderia sp. 383 chromosome 2, complete sequence
ATGTCAATCAGCATCGCAGTCGTCGGGGACGCAACCGACCATGGCGGCCGGATCATTACCGGCTCTGATA
CGCACAAGATCGGCGGCAAGAAAATAGCCCGTCTGCACGATCTGGTCGACTGTCCGGAAACCTATCCGGA
CGGGCGTCCGCACGGCATCAACAAGATTATCGAAGCCCATCCGACGCTTAGCGTCGGCGGGCGTTACGTG
GCATTGCACGGGCATCGCACCGAGTGCGGCTGCCGGCTGATTGCGACTTCGACAGCCAAGGTAGGGCGCT
AG