SecReT6
Protein ID: 78061841
SecReT6 ID105
T6SS typei3
Gene symbol-
Locus tagBcep18194_B0991
StrainBurkholderia sp. 383
Repliconchromosome 2 [GenBank: NC_007511] [Browse all T6SS(s) in this replicon]
Location [Strand]1108818..1110122 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ398K6
KEGG IDbur:Bcep18194_B0991
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.20E-62, Aligned region: 58..268
OmpA [PF00691], Evalue: 2.10E-17, Aligned region: 328..426
Protein Sequence: 434 a.a.     [Download]
>gi|78061841|ref|YP_371749.1| hypothetical protein Bcep18194_B0991 [Burkholderia sp. 383]
MSTPRKSSTPFGVAHTPANGEEALEKALNREGDTPVSQDIAPPEVFEQRLAKVKAASNPLLEASRVLLRA
QADMPETFESKDATVLLRTLLVEEVRVFERLCEQANIRRDHMIGASYCLCTALDEAVAQTAWGKNGSSAI
EWINGGLATTFHGDLKGGDKVYLLIGRLLEDPDEHRDILQVIYRILSLGFEGRYRGVADGPRKHDAIRQR
LYNVITSQREPVPLTLSPHWQSTAHGKRLSFTDFPVWITVTVLSVILLGLFGWFKYELFSRSADIQKQIV
DIARMTPPPAPPRQLHLKQLLKDEIAAGTVSVDEDARHSAVTFRGDAMFKPGGASVQASMNPLILKIAGE
VAKVPGKVTIIGYTDNVPIRSRHFASNQVLSEERAIQVMQMLQAAGVPASRLEAVGKGDTDPVGDNRTAQ
GRAQNRRVEIDVAR
 
Nucleotide Sequence: 1305 bp     [Download]
>gi|78060853|ref|NC_007511.1|:1108818-1110122 Burkholderia sp. 383 chromosome 2, complete sequence
ATGTCGACACCAAGGAAATCCAGTACGCCGTTTGGCGTCGCGCACACTCCCGCGAATGGCGAGGAAGCAT
TGGAGAAAGCGCTGAACCGGGAGGGCGATACACCTGTCAGTCAGGATATTGCACCTCCCGAAGTTTTCGA
GCAGCGTCTGGCCAAGGTCAAGGCCGCTTCGAATCCCTTGCTCGAGGCATCGCGCGTCTTGCTGCGTGCG
CAGGCCGACATGCCCGAAACGTTCGAGTCGAAAGATGCAACCGTGTTGTTACGGACGCTTCTCGTGGAAG
AGGTCCGCGTGTTCGAGAGACTATGCGAACAGGCCAATATTCGACGCGACCACATGATCGGCGCGAGCTA
CTGTCTGTGTACGGCACTCGACGAAGCGGTAGCGCAAACCGCATGGGGCAAGAATGGCTCATCGGCGATC
GAATGGATCAATGGCGGTCTTGCGACCACTTTCCACGGAGACCTCAAGGGTGGCGACAAGGTCTATCTTC
TGATTGGCCGCTTGCTGGAGGATCCGGATGAGCACCGGGACATCCTTCAAGTGATTTACCGGATTCTCAG
TCTCGGCTTCGAAGGACGCTACCGAGGCGTGGCTGATGGCCCGCGCAAGCACGACGCGATTCGTCAACGG
CTCTACAACGTGATTACATCGCAGCGCGAACCCGTACCGCTGACGCTATCGCCCCACTGGCAATCGACCG
CGCATGGCAAGCGCTTGTCGTTCACCGATTTTCCGGTATGGATCACCGTCACGGTCTTGTCGGTGATCCT
GCTCGGACTGTTCGGATGGTTCAAGTACGAACTGTTTAGCCGCAGCGCGGACATCCAGAAGCAGATTGTC
GACATCGCCCGCATGACACCACCGCCTGCGCCGCCACGGCAATTGCACCTCAAGCAATTGCTCAAGGATG
AAATCGCGGCCGGCACGGTCAGTGTCGACGAGGATGCCCGCCACAGCGCCGTCACGTTCCGCGGCGACGC
GATGTTCAAGCCCGGCGGGGCTTCGGTTCAGGCATCGATGAATCCGCTGATCTTGAAGATCGCGGGCGAG
GTCGCCAAGGTGCCGGGCAAGGTCACGATCATCGGCTACACGGACAACGTTCCGATTCGCAGCCGGCATT
TCGCATCGAATCAGGTGCTGTCGGAAGAGCGCGCCATCCAGGTCATGCAGATGCTGCAAGCCGCGGGGGT
GCCGGCAAGCCGGCTCGAAGCCGTCGGCAAGGGCGATACCGATCCGGTTGGCGACAACCGAACTGCGCAG
GGACGTGCGCAAAACCGCCGCGTCGAGATCGACGTCGCACGATAA

Protein ID: 78061843
SecReT6 ID105
T6SS typei3
Gene symbol-
Locus tagBcep18194_B0993
StrainBurkholderia sp. 383
Repliconchromosome 2 [GenBank: NC_007511] [Browse all T6SS(s) in this replicon]
Location [Strand]1114275..1115489 [+]
ProductOmpA/MotB family outer membrane protein
NoteTssL
UniProt IDQ398K4
KEGG IDbur:Bcep18194_B0993
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.80E-52, Aligned region: 32..246
DUF2077 [PF09850], Evalue: 2.80E-52, Aligned region: 257..272
OmpA [PF00691], Evalue: 4.20E-12, Aligned region: 297..396
Protein Sequence: 404 a.a.     [Download]
>gi|78061843|ref|YP_371751.1| OmpA/MotB family outer membrane protein [Burkholderia sp. 383]
MVLSTTDPQGHAGAMASPSVAARLKAAEQAINPLLEASRVLLHALAETPATLDADAIARWRRWLGQEIRL
FTWLCSELRLRPEHVRCASYCLCSALDEAAMRTPWGKGKTTGVEWQDNSLASALGHDRQGGDRVFQLIDD
AMRNQRENLDLIELYQNVLDLGFRGRYRFEAGGQKRLQVIREHVHDAVMTGGQSVNRVSEPRKRPRQTID
PWVRPVPVRRSRARFAGGLIVALLLGAGGYVAADRWVRTNEGLRASQLDVLARNLEQQLRDEVAAGNVEL
IRDSGRNALTLRFSGMFGPGEATVAPWGASVVASAGREIAAVTKGATLRVAGYADSTPISSTRQASNQVL
SDVRARHVAQILVAAGVSAPRISVEGNGDADSLADNGTASGRARNRRVEVTISD
 
Nucleotide Sequence: 1215 bp     [Download]
>gi|78060853|ref|NC_007511.1|:1114275-1115489 Burkholderia sp. 383 chromosome 2, complete sequence
ATGGTTCTTTCGACAACCGATCCGCAGGGCCATGCAGGGGCCATGGCGTCGCCGTCTGTTGCCGCACGGC
TGAAAGCCGCGGAGCAGGCGATCAACCCGCTGCTCGAAGCGTCGCGCGTCCTGTTGCACGCGTTGGCCGA
GACGCCCGCAACGCTCGATGCCGATGCCATTGCACGGTGGCGTCGATGGCTGGGGCAGGAAATTCGTCTC
TTCACCTGGCTCTGCAGTGAACTCCGGCTCCGACCCGAGCACGTCCGATGCGCCAGCTATTGTTTGTGCT
CCGCGCTCGACGAGGCGGCGATGCGGACGCCTTGGGGAAAGGGCAAAACAACCGGCGTCGAATGGCAGGA
CAACAGCCTGGCGAGCGCGTTGGGGCATGATCGTCAGGGCGGCGACCGTGTTTTCCAACTGATCGACGAC
GCCATGCGTAATCAGCGCGAGAACCTCGATCTCATCGAGTTGTACCAAAACGTACTCGATCTCGGGTTCC
GTGGGCGATACCGATTCGAAGCAGGCGGTCAAAAGCGCTTGCAGGTCATTCGCGAACACGTACACGACGC
GGTGATGACCGGAGGGCAGAGCGTGAATCGCGTTAGCGAGCCGCGGAAACGTCCGCGACAGACGATCGAT
CCGTGGGTACGTCCGGTGCCGGTGCGCCGGTCGCGAGCGAGGTTCGCAGGCGGTCTCATTGTTGCGCTGT
TGCTGGGGGCAGGGGGCTACGTCGCGGCGGACCGTTGGGTGCGCACGAATGAGGGGCTCCGGGCATCGCA
GCTCGATGTGCTCGCCCGAAACCTGGAGCAGCAACTTCGCGACGAGGTCGCTGCAGGGAATGTCGAACTG
ATCCGCGACTCCGGGCGCAATGCGTTGACGCTCCGATTCAGCGGCATGTTTGGGCCAGGCGAGGCAACGG
TGGCGCCGTGGGGTGCTTCGGTGGTGGCTTCGGCTGGCCGGGAAATCGCCGCTGTGACCAAGGGCGCGAC
CCTCCGGGTTGCGGGATACGCGGACAGCACTCCGATCAGTTCGACACGTCAAGCATCTAACCAGGTGCTT
TCCGACGTACGCGCTCGGCACGTGGCTCAAATTCTCGTTGCGGCTGGCGTATCGGCGCCGCGTATCAGTG
TCGAGGGAAACGGCGATGCCGATTCGCTGGCGGACAACGGTACCGCGTCGGGAAGGGCGAGAAACCGGCG
AGTCGAAGTGACTATTTCAGACTGA