SecReT6
Protein ID: 78062431
SecReT6 ID106
T6SS typei3
Gene symbol-
Locus tagBcep18194_B1581
StrainBurkholderia sp. 383
Repliconchromosome 2 [GenBank: NC_007511] [Browse all T6SS(s) in this replicon]
Location [Strand]1794239..1796512 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ396B6
KEGG IDbur:Bcep18194_B1581
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.90E-86, Aligned region: 25..325
Phage_base_V [PF04717], Evalue: 1.80E-24, Aligned region: 364..456
Gp5_C [PF06715], Evalue: 3.50E-06, Aligned region: 509..527
Gp5_C [PF06715], Evalue: 3.50E-06, Aligned region: 516..539
Gp5_C [PF06715], Evalue: 3.50E-06, Aligned region: 525..547
Gp5_C [PF06715], Evalue: 3.50E-06, Aligned region: 532..547
Gp5_C [PF06715], Evalue: 3.50E-06, Aligned region: 556..578
Gp5_C [PF06715], Evalue: 3.50E-06, Aligned region: 582..605
Gp5_C [PF06715], Evalue: 3.50E-06, Aligned region: 598..622
Protein Sequence: 757 a.a.     [Download]
>gi|78062431|ref|YP_372339.1| Rhs element Vgr protein [Burkholderia sp. 383]
MNRVFTLDSLHGDDLKFHTLDGSDELGRLFEFRIEALADSHSLSLKDLLGKPVTVRIEQQDLSTRYLNGI
VARASLSGRRAERYYGYELIVRPWLWLATRRSDCRIFQNKTVPEIMQEVLATYGFPIENHLAESYVPRDY
CVQYNETDAAFVSRLMEFEGIYFWFRHAEDTHTLMLGDAMSSHTVLPGYETIPYIARDRTAIADEEHIDG
WLPAQEVSVGRHQTTDYDYTKPRADLSSQKVDPRGHDHDSFASFEWPGGYRDDAPGAHYSRVRLEEQQAE
HERASADTDVRGVAPGYLFTLEHCPRADQNREYLIVRCQYRFQENAYASDQGAEAVVHQTMMLVQPSSLP
YRSPRDTPRPRTNGPQTATVVGPPGEEIWTDQYGRVKLQFRWDRYGQSNQDSSCWVRVSSPWAGGGFGGV
QIPRVGDEVVVDFLNGDPDEPIVTGRVFNGEKMPPWGLPGSATQSGLLSRSSPGGTTDHANAFRFEDKKG
AEQLWMHAERNFDAETELDHSLSVGNNHTHTVGNDETMQVKNNRQRSVGQNETVNIGQNRVAQIGANETH
GVTGNRSVSVDGNSSHTVTKGNHNLAVVAGTHDVFVEGNSTHVVGTGSYATKVNTGNHSVDVNKVASLAA
GQYIDMGSGKSGVSINKDNVGVSIGGTGGDTGVGISGQGGGVAIAGYGKGVNIAGYAPGVTIYGENDLNL
SGKSTANLQAPTVNIDNGKSSCTVNVNATRIVLATGGGSITLDGSGVTIQGTIAHIN
 
Nucleotide Sequence: 2274 bp     [Download]
>gi|78060853|ref|NC_007511.1|:c1796512-1794239 Burkholderia sp. 383 chromosome 2, complete sequence
TTGAATCGCGTATTCACACTCGACAGCCTGCACGGCGACGACCTCAAGTTCCATACGCTCGACGGCAGCG
ACGAACTCGGCCGCCTGTTCGAATTCCGGATCGAGGCGCTCGCCGACAGTCACAGCCTGTCGCTGAAGGA
CTTGCTCGGCAAGCCGGTGACGGTCCGGATCGAACAGCAGGACCTGTCGACCCGCTACCTGAACGGTATC
GTTGCGCGTGCGTCGCTTTCCGGCCGGCGCGCCGAGCGGTATTACGGCTACGAGCTGATCGTGCGCCCAT
GGCTGTGGCTCGCGACGCGACGCTCCGATTGCCGGATCTTCCAGAACAAGACCGTGCCCGAGATCATGCA
GGAAGTGCTGGCGACGTACGGCTTTCCGATCGAGAACCATCTCGCCGAGTCGTATGTGCCGCGCGACTAT
TGCGTGCAGTACAACGAGACCGATGCCGCGTTCGTGTCGCGGCTGATGGAGTTCGAGGGGATCTACTTCT
GGTTCCGGCATGCCGAGGACACGCATACGCTGATGCTCGGTGACGCGATGTCGTCGCACACCGTGCTGCC
CGGCTACGAGACGATTCCGTACATCGCGCGCGACCGGACGGCGATCGCCGACGAGGAGCATATCGACGGC
TGGCTGCCCGCGCAGGAAGTGAGTGTCGGGCGGCACCAGACCACCGACTACGACTATACGAAGCCGCGCG
CCGATCTTTCGTCGCAGAAGGTCGATCCGCGTGGTCACGATCACGACAGTTTCGCGTCGTTCGAATGGCC
GGGCGGCTATCGCGACGATGCGCCCGGCGCACACTACAGCCGCGTGCGGCTCGAGGAACAGCAGGCCGAG
CACGAGCGGGCGAGTGCCGATACCGATGTGCGTGGTGTCGCGCCCGGTTATCTGTTCACGCTCGAACATT
GCCCGCGCGCGGATCAGAACCGTGAGTACCTGATCGTGCGATGCCAGTACCGCTTCCAGGAGAACGCGTA
TGCGAGCGACCAGGGCGCGGAGGCCGTCGTGCATCAGACGATGATGCTCGTGCAGCCGTCGAGCCTGCCT
TACCGGTCGCCGCGCGACACGCCGCGGCCGCGGACCAACGGGCCGCAGACGGCAACCGTGGTCGGGCCGC
CCGGGGAGGAAATCTGGACCGACCAGTATGGGCGCGTGAAGCTGCAGTTCCGCTGGGATCGGTATGGGCA
AAGCAATCAGGATTCGTCGTGCTGGGTGCGGGTGTCGAGTCCCTGGGCCGGGGGCGGGTTCGGGGGCGTG
CAGATTCCGCGGGTAGGCGATGAGGTGGTTGTCGATTTTCTGAATGGCGATCCGGATGAGCCGATCGTCA
CCGGGCGAGTTTTCAACGGCGAGAAGATGCCGCCGTGGGGGCTGCCGGGGAGTGCGACGCAGAGCGGGTT
GCTGTCCAGATCTTCACCGGGCGGAACGACTGATCACGCCAACGCGTTCCGGTTCGAGGACAAGAAGGGC
GCCGAGCAACTCTGGATGCACGCGGAAAGGAATTTCGATGCGGAGACGGAGCTCGATCATTCGCTTTCTG
TCGGGAACAACCATACGCATACGGTCGGGAACGACGAAACGATGCAGGTGAAGAACAACCGGCAACGGAG
TGTGGGGCAGAACGAGACGGTGAATATCGGGCAGAACAGGGTGGCGCAGATTGGGGCGAATGAGACGCAT
GGGGTGACGGGGAACCGCAGCGTATCGGTCGACGGCAACAGTTCGCATACGGTGACCAAGGGGAATCACA
ACCTGGCGGTGGTCGCCGGCACGCATGACGTCTTCGTCGAGGGGAACAGCACGCATGTCGTCGGTACCGG
ATCGTATGCGACGAAGGTCAATACGGGAAACCATTCCGTGGACGTCAACAAAGTCGCTTCATTGGCGGCC
GGCCAATACATCGACATGGGTTCAGGAAAGAGTGGCGTGTCGATCAACAAGGACAACGTCGGCGTCTCCA
TCGGCGGAACCGGAGGCGATACCGGTGTCGGGATCAGCGGCCAGGGTGGCGGTGTGGCCATCGCCGGATA
CGGCAAGGGCGTCAACATTGCGGGCTACGCACCTGGCGTGACGATTTACGGCGAGAACGATCTCAATCTT
TCCGGCAAGTCGACGGCCAATCTTCAGGCACCGACGGTCAACATCGACAACGGCAAGAGTAGCTGCACCG
TCAACGTCAACGCGACGAGGATCGTTCTGGCGACCGGTGGCGGCTCGATCACGCTCGACGGATCGGGCGT
GACGATCCAGGGGACGATTGCCCACATCAATTGA