SecReT6
Protein ID: 78062432
SecReT6 ID106
T6SS typei3
Gene symbol-
Locus tagBcep18194_B1582
StrainBurkholderia sp. 383
Repliconchromosome 2 [GenBank: NC_007511] [Browse all T6SS(s) in this replicon]
Location [Strand]1796509..1799172 [-]
ProductATPase AAA
NoteTssH
UniProt IDQ396B5
KEGG IDbur:Bcep18194_B1582
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.40E-38, Aligned region: 228..306
AAA_2 [PF07724], Evalue: 5.40E-38, Aligned region: 484..523
AAA_2 [PF07724], Evalue: 5.40E-38, Aligned region: 615..781
AAA [PF00004], Evalue: 1.60E-18, Aligned region: 229..329
AAA [PF00004], Evalue: 1.60E-18, Aligned region: 620..703
ClpB_D2-small [PF10431], Evalue: 8.60E-12, Aligned region: 212..223
ClpB_D2-small [PF10431], Evalue: 8.60E-12, Aligned region: 787..861
AAA_5 [PF07728], Evalue: 2.70E-11, Aligned region: 229..255
AAA_5 [PF07728], Evalue: 2.70E-11, Aligned region: 619..718
AAA_16 [PF13191], Evalue: 1.70E-10, Aligned region: 32..78
AAA_16 [PF13191], Evalue: 1.70E-10, Aligned region: 206..252
AAA_16 [PF13191], Evalue: 1.70E-10, Aligned region: 447..538
AAA_16 [PF13191], Evalue: 1.70E-10, Aligned region: 589..663
AAA_16 [PF13191], Evalue: 1.70E-10, Aligned region: 684..702
AAA_22 [PF13401], Evalue: 1.10E-08, Aligned region: 229..309
AAA_22 [PF13401], Evalue: 1.10E-08, Aligned region: 369..395
AAA_22 [PF13401], Evalue: 1.10E-08, Aligned region: 616..648
Sigma54_activat [PF00158], Evalue: 5.80E-07, Aligned region: 212..255
Sigma54_activat [PF00158], Evalue: 5.80E-07, Aligned region: 606..733
IstB_IS21 [PF01695], Evalue: 3.60E-06, Aligned region: 223..248
IstB_IS21 [PF01695], Evalue: 3.60E-06, Aligned region: 618..640
IstB_IS21 [PF01695], Evalue: 3.60E-06, Aligned region: 729..750
AAA_19 [PF13245], Evalue: 7.50E-06, Aligned region: 226..251
AAA_19 [PF13245], Evalue: 7.50E-06, Aligned region: 613..641
Zeta_toxin [PF06414], Evalue: 4.70E-05, Aligned region: 229..249
Zeta_toxin [PF06414], Evalue: 4.70E-05, Aligned region: 613..659
FtsK_SpoIIIE [PF01580], Evalue: 5.50E-05, Aligned region: 223..271
FtsK_SpoIIIE [PF01580], Evalue: 5.50E-05, Aligned region: 433..527
FtsK_SpoIIIE [PF01580], Evalue: 5.50E-05, Aligned region: 604..636
NACHT [PF05729], Evalue: 8.30E-05, Aligned region: 229..265
NACHT [PF05729], Evalue: 8.30E-05, Aligned region: 619..647
AAA_17 [PF13207], Evalue: 0.00018, Aligned region: 230..246
AAA_17 [PF13207], Evalue: 0.00018, Aligned region: 618..655
AAA_25 [PF13481], Evalue: 0.00035, Aligned region: 210..253
AAA_25 [PF13481], Evalue: 0.00035, Aligned region: 285..321
AAA_25 [PF13481], Evalue: 0.00035, Aligned region: 479..536
AAA_25 [PF13481], Evalue: 0.00035, Aligned region: 614..641
AAA_25 [PF13481], Evalue: 0.00035, Aligned region: 791..824
AAA_14 [PF13173], Evalue: 0.00042, Aligned region: 282..309
AAA_14 [PF13173], Evalue: 0.00042, Aligned region: 617..701
RuvB_N [PF05496], Evalue: 0.0011, Aligned region: 228..245
RuvB_N [PF05496], Evalue: 0.0011, Aligned region: 297..309
RuvB_N [PF05496], Evalue: 0.0011, Aligned region: 585..640
RuvB_N [PF05496], Evalue: 0.0011, Aligned region: 688..712
Clp_N [PF02861], Evalue: 0.0012, Aligned region: 29..65
Clp_N [PF02861], Evalue: 0.0012, Aligned region: 117..131
AAA_29 [PF13555], Evalue: 0.0014, Aligned region: 221..241
AAA_29 [PF13555], Evalue: 0.0014, Aligned region: 615..644
ResIII [PF04851], Evalue: 0.002, Aligned region: 222..250
ResIII [PF04851], Evalue: 0.002, Aligned region: 289..310
ResIII [PF04851], Evalue: 0.002, Aligned region: 591..641
AAA_18 [PF13238], Evalue: 0.0025, Aligned region: 230..248
AAA_18 [PF13238], Evalue: 0.0025, Aligned region: 620..645
TIP49 [PF06068], Evalue: 0.0074, Aligned region: 229..250
TIP49 [PF06068], Evalue: 0.0074, Aligned region: 279..309
TIP49 [PF06068], Evalue: 0.0074, Aligned region: 586..654
Hpr_kinase_C [PF07475], Evalue: 0.0093, Aligned region: 229..242
Hpr_kinase_C [PF07475], Evalue: 0.0093, Aligned region: 620..636
RNA_helicase [PF00910], Evalue: 0.0097, Aligned region: 230..250
RNA_helicase [PF00910], Evalue: 0.0097, Aligned region: 620..641
Protein Sequence: 887 a.a.     [Download]
>gi|78062432|ref|YP_372340.1| AAA ATPase, Clp [Burkholderia sp. 383]
MSDIGRANLFGKLNPFLYETLEQATGFCRLRGNPYVELAHWFKQMLQRPDGDLQRVLRHFGVDDAVVDRG
LVTALDKLPRGAGSVSDLSVHIDDAVERAWVYATLKYDATRIRGAVLLLAILKTPQLRNVLLAITREFER
IVPDVLADALGSIVEGSPEAQAAGQTAPGGDTAMRGATTAAADGSALSRFAVDLTARARAGEIDPVIGRD
PEIRQIVDILLRRRQNNPLLVGEAGVGKTAVAEGFALRIAAGDVPPSLQDVALYLLDIGLLQAGASVKGE
FESRLRGVIDEAMSSERPAILFIDEVHTLVGAGGAAGTGDAANLLKPALARGLLRTIGATTWSEYKQYIE
KDPALTRRFQLVHVHEPEEAAALTMLRGLAGKLEAHHRVLVLDDALQAAVTLSHRYIPARQLPDKAISLL
DTACARVAVSQHAVPAPIEDARRRIDSLRVEQERIGRECALGTGDTARRDAIEHDIATARTELDRLDTRW
QTERDALTAIVDARALLLDDDPSHALDADARTAAQTRLSAAQQALADLQGEAPLVLPAVDTHAVAAVVAD
WTGIPLGRMVRDETQAVLKLADTLGERVVGQKHAVELIAERIQTARAKLDDPKKPHGVFLLCGPSGVGKT
ETALALADTLYGGEHNAITINMSEFQEAHTVSTLKGAPPGYVGYGQGGVLTEAVRRRPYSVVLLDEIEKA
HRDVHEIFFQVFDKGWMEDGEGRDIDFRHTVILLTSNVGADRVMQLCRDPEHLPDTQTLADALRAPLLDV
FPAALLGRLTVVPYYPLTDATLARIVALQLRRIEQRIDAHHGIRLRCTDAATALVVERCRTIESGGRMVD
AILTHTVMPRIGRAILQATLEGRTLASIELSAADGEFAYRFDEEETT
 
Nucleotide Sequence: 2664 bp     [Download]
>gi|78060853|ref|NC_007511.1|:c1799172-1796509 Burkholderia sp. 383 chromosome 2, complete sequence
ATGTCCGATATCGGCCGCGCCAATCTGTTCGGAAAACTGAATCCGTTCCTCTACGAGACGCTCGAGCAGG
CGACCGGCTTCTGCCGGCTGCGCGGCAATCCGTACGTCGAGCTTGCGCACTGGTTCAAGCAGATGCTGCA
ACGGCCCGACGGCGACCTGCAGCGCGTGCTGCGCCACTTCGGGGTCGATGACGCCGTGGTCGACCGCGGG
CTCGTTACCGCGCTCGACAAGCTGCCGCGCGGCGCGGGCTCGGTGTCGGATCTGTCCGTGCATATCGACG
ACGCGGTCGAGCGCGCATGGGTCTACGCGACGCTGAAGTACGACGCGACGCGCATTCGCGGCGCGGTGCT
GCTGCTCGCAATCCTGAAGACGCCGCAGTTGCGCAACGTGCTGCTGGCGATCACGCGCGAATTCGAACGC
ATCGTGCCGGACGTGCTCGCCGATGCGCTCGGGTCGATCGTCGAAGGTTCGCCGGAGGCGCAGGCGGCCG
GGCAGACGGCTCCCGGCGGCGACACGGCAATGCGCGGTGCAACCACAGCCGCCGCCGACGGCTCGGCGCT
CTCGCGTTTCGCCGTCGACCTGACTGCCCGCGCGCGGGCCGGCGAGATCGACCCAGTGATCGGACGCGAT
CCGGAGATTCGCCAGATCGTCGACATCCTGCTGCGGCGCCGGCAGAACAACCCGCTGCTGGTCGGCGAAG
CCGGCGTCGGCAAGACGGCCGTCGCGGAGGGTTTCGCGCTGCGGATCGCTGCCGGCGACGTGCCGCCGTC
GCTGCAGGACGTTGCGCTGTACCTGCTCGACATCGGGCTGCTGCAGGCCGGCGCGAGCGTGAAGGGCGAG
TTCGAGAGCCGGTTGCGCGGCGTGATCGACGAAGCAATGTCGTCCGAGCGGCCGGCGATCCTGTTCATCG
ACGAAGTCCACACGCTGGTCGGCGCGGGCGGGGCTGCCGGCACCGGCGACGCCGCGAACCTGCTGAAACC
GGCGCTCGCCCGCGGCCTGCTGCGCACGATCGGCGCGACGACGTGGTCCGAGTACAAGCAGTACATCGAG
AAGGACCCGGCGCTGACGCGGCGTTTCCAGCTCGTGCACGTACACGAACCGGAAGAAGCGGCCGCGCTGA
CGATGCTGCGCGGCCTCGCCGGGAAGCTCGAGGCCCACCACCGCGTGCTCGTGCTCGACGACGCGCTGCA
GGCTGCCGTCACGCTGTCGCACCGTTACATTCCGGCCCGCCAGTTGCCGGACAAGGCGATCAGCCTGCTC
GATACGGCCTGCGCGCGCGTCGCTGTCAGCCAGCACGCGGTGCCCGCGCCGATCGAAGATGCGCGCCGCC
GGATCGACAGCCTGCGCGTCGAACAGGAGCGGATCGGACGCGAATGCGCGCTCGGCACCGGCGATACCGC
ACGGCGCGATGCGATCGAGCACGACATTGCCACCGCCCGAACCGAACTCGACCGGCTGGACACGCGCTGG
CAAACCGAACGCGACGCATTGACGGCGATCGTCGATGCCCGTGCGTTGCTGCTCGACGACGATCCGTCGC
ATGCGCTCGATGCCGATGCGCGCACTGCGGCACAAACCCGTCTCTCGGCCGCGCAGCAGGCGCTGGCCGA
CCTGCAGGGCGAGGCGCCCCTCGTGCTGCCCGCCGTCGACACGCACGCGGTAGCAGCCGTCGTGGCCGAC
TGGACCGGCATTCCGCTCGGTCGCATGGTGCGCGACGAAACGCAGGCCGTGCTGAAGCTGGCCGATACGC
TCGGCGAGCGCGTCGTCGGCCAGAAGCACGCGGTCGAGCTGATCGCCGAGCGCATCCAGACCGCGCGGGC
CAAGCTCGACGATCCGAAGAAGCCGCATGGCGTGTTCCTGCTGTGCGGCCCGTCCGGCGTCGGCAAGACC
GAGACCGCGCTCGCGCTGGCCGACACGCTGTACGGCGGCGAACACAACGCGATCACGATCAACATGAGCG
AGTTTCAGGAAGCGCATACCGTGTCGACGCTGAAGGGCGCGCCGCCCGGTTATGTCGGCTACGGGCAGGG
CGGGGTGCTGACCGAGGCCGTGCGGCGCCGTCCGTACAGCGTCGTGCTGCTCGACGAGATCGAGAAGGCG
CACCGCGACGTGCACGAGATTTTCTTCCAGGTGTTCGACAAGGGCTGGATGGAGGATGGCGAAGGGCGCG
ACATCGATTTCCGGCATACGGTGATCCTGCTGACGTCGAACGTTGGCGCCGATCGCGTGATGCAGCTGTG
CCGCGATCCCGAGCACCTGCCCGACACGCAGACGCTCGCCGATGCGCTGCGCGCGCCGCTGCTCGACGTG
TTTCCCGCTGCGTTGCTCGGCCGGTTGACCGTCGTGCCGTACTACCCGCTCACCGACGCGACGCTTGCGC
GGATCGTCGCATTGCAGTTGCGGCGGATCGAGCAGCGGATCGACGCGCACCACGGCATCCGGCTGCGCTG
CACCGACGCGGCGACCGCGCTGGTCGTCGAGCGCTGCCGGACGATCGAATCCGGCGGCCGGATGGTCGAC
GCGATCCTCACGCATACCGTGATGCCGCGCATCGGCCGCGCGATCCTGCAGGCCACGCTCGAAGGCCGCA
CGCTGGCGTCGATCGAGCTGAGCGCCGCCGACGGCGAATTCGCGTACCGGTTCGACGAGGAGGAAACGAC
TTGA