SecReT6
Protein ID: 78062434
SecReT6 ID106
T6SS typei3
Gene symbol-
Locus tagBcep18194_B1584
StrainBurkholderia sp. 383
Repliconchromosome 2 [GenBank: NC_007511] [Browse all T6SS(s) in this replicon]
Location [Strand]1800285..1802156 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ396B3
KEGG IDbur:Bcep18194_B1584
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.50E-213, Aligned region: 5..622
Protein Sequence: 623 a.a.     [Download]
>gi|78062434|ref|YP_372342.1| hypothetical protein Bcep18194_B1584 [Burkholderia sp. 383]
MDTRLLDYYNRELAYLRELGGEFAQQFPKVAARLRLNESGPPDPYVERLLEGFSFLTARVQLKMDAEFPR
FTQALLDAVYPGYIAPLPSMAIVRFAPMLNEGSLAQGWRLPAGTALRARPAASEQTACEFRTAHDLTLWP
LELTDATVTGAPSWLPRGAFAARQDVRGALRIRLKVRGGAKLSQLPLDRLTFHLAGPERDALHLLELIAA
HALGVVCHDPAQPPRWLHTLDADEIVHEGFDPAQAILPDDGRSFHGYRLLREYFAFPARFLFFSIGGLRA
ALARATGDEFELTVLFDRHDAALEAAVSAKHLALNCTPAVNLFARRADRIPLQPGAREHHVVVDRSRPLD
YEVYAVQRLASEQRDDGQSREFRPFHASFATDDGNHGAYYMVRREPRLVSSQARANGTRTGYVGSETYVS
LVDSQCAPYDETMRYLAADTLCTNRDLVLLQPPGDANTFTLRVSAPVESIVAIRGPSRPRPPIADAQTAW
RLIRHLGLARHTLTDLDDDEGAHALRELLGLHADPADAAMRRQIDGVLRVAFSPVFRRLPASGPLMFGRG
VQVDVTVDDHAFSGDSPFLLGAVLEQFFARHVSINAFAECVLTSAQRGQLAHWPARIGRRPAI
 
Nucleotide Sequence: 1872 bp     [Download]
>gi|78060853|ref|NC_007511.1|:c1802156-1800285 Burkholderia sp. 383 chromosome 2, complete sequence
ATGGATACGCGCCTGCTCGACTACTACAACCGCGAACTCGCGTACCTGCGCGAGCTCGGCGGCGAATTCG
CGCAGCAGTTCCCGAAAGTGGCCGCGCGGCTGCGGCTCAACGAATCGGGGCCGCCCGACCCGTACGTCGA
GCGGCTGCTAGAAGGCTTCAGCTTTCTCACCGCGCGCGTGCAGCTCAAGATGGACGCCGAGTTTCCGCGC
TTCACGCAGGCGTTGCTCGATGCCGTGTATCCCGGCTACATCGCGCCGCTGCCGTCGATGGCGATCGTGC
GGTTCGCGCCGATGCTGAACGAAGGCAGCCTCGCACAAGGCTGGCGGCTGCCGGCCGGCACCGCGCTGCG
CGCGCGTCCGGCCGCATCCGAGCAGACCGCGTGCGAATTCCGCACCGCGCACGACCTGACGCTGTGGCCG
CTCGAACTGACCGATGCGACCGTCACCGGCGCGCCGTCGTGGCTGCCGCGTGGCGCCTTCGCCGCCCGGC
AGGACGTGCGCGGCGCGCTGCGCATCCGGCTGAAGGTGCGCGGCGGTGCCAAACTGTCCCAGTTGCCGCT
CGACCGGCTGACGTTCCATCTCGCGGGCCCCGAGCGCGACGCACTGCACCTGCTCGAACTGATCGCCGCG
CATGCGCTCGGTGTCGTGTGCCACGATCCCGCGCAGCCGCCGCGCTGGCTGCATACGCTCGACGCCGACG
AGATCGTCCACGAAGGCTTCGATCCCGCCCAGGCGATCCTGCCCGACGACGGCCGCAGCTTCCACGGCTA
CCGGCTGCTGCGCGAGTATTTCGCGTTTCCGGCGCGCTTCCTGTTCTTCAGCATCGGCGGGCTACGCGCC
GCGCTCGCACGCGCAACCGGCGACGAGTTCGAGCTGACCGTGCTGTTCGACCGCCATGACGCGGCACTCG
AAGCGGCCGTCAGCGCGAAACACCTCGCGCTGAACTGCACGCCGGCCGTGAACCTGTTCGCGCGCCGTGC
CGACCGCATTCCGCTGCAACCGGGCGCGCGTGAGCACCATGTCGTCGTCGATCGCAGCCGGCCGCTCGAC
TACGAGGTCTATGCAGTGCAGCGGCTCGCGAGCGAGCAGCGCGACGACGGCCAGTCACGCGAATTCCGGC
CGTTTCATGCGTCGTTCGCGACCGACGACGGCAACCACGGCGCGTACTACATGGTGCGACGCGAACCGAG
GCTGGTCTCCTCGCAGGCACGTGCGAACGGCACGCGCACCGGCTACGTCGGCAGCGAGACCTACGTGTCG
CTCGTCGACAGCCAGTGCGCGCCGTACGACGAGACGATGCGCTACCTGGCGGCCGACACGCTGTGCACGA
ACCGCGACCTCGTGCTGCTGCAGCCGCCCGGCGACGCGAACACGTTCACGCTGCGCGTGTCGGCCCCGGT
CGAAAGCATCGTCGCGATCCGCGGCCCGTCGCGGCCGCGCCCGCCGATCGCCGATGCGCAAACCGCGTGG
CGGCTGATCCGCCATCTCGGGCTGGCCCGGCACACGCTGACCGATCTCGACGACGACGAGGGCGCGCATG
CGCTGCGCGAACTGCTCGGCCTGCATGCCGACCCGGCCGATGCCGCAATGCGCCGGCAGATCGACGGCGT
GCTGCGTGTGGCGTTCTCGCCAGTGTTCCGCCGGCTGCCGGCGTCAGGCCCGCTGATGTTCGGGCGCGGC
GTGCAGGTCGACGTGACCGTTGACGACCATGCGTTCTCCGGTGACAGCCCGTTCCTGCTCGGCGCGGTGC
TCGAACAGTTCTTCGCGCGCCACGTGTCGATCAACGCGTTCGCCGAATGCGTGCTGACCAGCGCGCAGCG
GGGCCAGCTCGCCCACTGGCCGGCGCGCATCGGCAGGCGGCCCGCGATATGA