SecReT6
Protein ID: 78062435
SecReT6 ID106
T6SS typei3
Gene symbol-
Locus tagBcep18194_B1585
StrainBurkholderia sp. 383
Repliconchromosome 2 [GenBank: NC_007511] [Browse all T6SS(s) in this replicon]
Location [Strand]1802161..1802709 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ396B2
KEGG IDbur:Bcep18194_B1585
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.30E-21, Aligned region: 46..160
Protein Sequence: 182 a.a.     [Download]
>gi|78062435|ref|YP_372343.1| hypothetical protein Bcep18194_B1585 [Burkholderia sp. 383]
MDDPRTRDGREGSLRDRLQPALLDRLTDDTPQRATEAPGAQWIGTERLRAAVLRDLAWLLNTRNAEDGFV
DWSAFAHAQASVLNYGMRPLVGKPMSGVERMSVEASIRDAIVRFEPRIAPDSVEVRSVIDAPGGRAGERR
HNVLLFEIRGTLWSIPHPLEFVLRSDLDFETGAMSLQSVAGA
 
Nucleotide Sequence: 549 bp     [Download]
>gi|78060853|ref|NC_007511.1|:c1802709-1802161 Burkholderia sp. 383 chromosome 2, complete sequence
ATGGACGACCCGCGAACCCGCGACGGCCGGGAGGGCAGCCTGCGCGACCGGCTCCAGCCCGCATTGCTCG
ACCGGCTCACCGACGACACGCCGCAGCGCGCGACCGAAGCGCCCGGCGCGCAGTGGATCGGCACCGAACG
CCTGCGTGCGGCCGTGCTGCGCGATCTCGCGTGGCTGCTCAACACGCGCAACGCCGAGGACGGCTTCGTC
GACTGGTCGGCGTTCGCGCACGCGCAGGCGTCGGTGCTCAACTACGGGATGCGGCCGCTCGTCGGCAAGC
CGATGTCGGGCGTCGAGCGGATGTCGGTCGAGGCATCGATCCGCGATGCGATCGTCCGCTTCGAGCCGCG
CATCGCGCCCGACAGCGTCGAAGTGCGCAGCGTGATCGACGCGCCGGGCGGCCGCGCCGGCGAGCGGCGC
CACAACGTGCTGCTGTTCGAGATTCGCGGCACGCTGTGGTCGATCCCGCATCCGCTCGAATTCGTGCTGC
GCTCCGACCTCGATTTCGAGACGGGCGCGATGTCGCTGCAATCGGTAGCGGGGGCCTGA