SecReT6
Protein ID: 78062436
SecReT6 ID106
T6SS typei3
Gene symbol-
Locus tagBcep18194_B1586
StrainBurkholderia sp. 383
Repliconchromosome 2 [GenBank: NC_007511] [Browse all T6SS(s) in this replicon]
Location [Strand]1802726..1803217 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ396B1
KEGG IDbur:Bcep18194_B1586
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.20E-34, Aligned region: 6..138
Protein Sequence: 163 a.a.     [Download]
>gi|78062436|ref|YP_372344.1| hypothetical protein Bcep18194_B1586 [Burkholderia sp. 383]
MGVAMFMKVDGVTGESADAQHKGWTDIQSFTWGASQPGAMASGSGGNAGKASFNDLVVAAYMDKGAPAII
KNCANGKHLSTVEISACKTGGTQVEFMRVTLQEVLVTSAQVAGIDPGDVADRLMMHYGFQAAKVKKQYWQ
QNDNGGKGAEVTVGWNIKENTEM
 
Nucleotide Sequence: 492 bp     [Download]
>gi|78060853|ref|NC_007511.1|:c1803217-1802726 Burkholderia sp. 383 chromosome 2, complete sequence
ATGGGCGTGGCAATGTTTATGAAGGTGGACGGCGTGACCGGCGAATCGGCGGACGCACAGCACAAGGGCT
GGACCGACATCCAGTCGTTCACGTGGGGCGCGAGCCAGCCGGGCGCGATGGCGAGCGGCAGCGGCGGCAA
TGCGGGCAAGGCGAGCTTCAACGATCTCGTCGTCGCCGCGTACATGGACAAGGGTGCACCCGCGATCATC
AAGAACTGCGCGAACGGCAAGCACCTTTCGACGGTCGAGATCTCCGCGTGCAAGACGGGCGGCACGCAGG
TCGAGTTCATGCGCGTGACGCTGCAGGAAGTGCTCGTCACGTCCGCGCAGGTCGCGGGCATCGATCCGGG
CGACGTCGCCGACCGGCTGATGATGCACTACGGCTTCCAGGCCGCGAAGGTGAAGAAGCAGTACTGGCAG
CAGAACGACAACGGCGGCAAGGGCGCGGAGGTGACCGTCGGCTGGAACATCAAGGAAAACACCGAGATGT
GA