SecReT6
Protein ID: 78062437
SecReT6 ID106
T6SS typei3
Gene symbol-
Locus tagBcep18194_B1587
StrainBurkholderia sp. 383
Repliconchromosome 2 [GenBank: NC_007511] [Browse all T6SS(s) in this replicon]
Location [Strand]1803289..1804797 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ396B0
KEGG IDbur:Bcep18194_B1587
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-193, Aligned region: 69..495
Protein Sequence: 502 a.a.     [Download]
>gi|78062437|ref|YP_372345.1| hypothetical protein Bcep18194_B1587 [Burkholderia sp. 383]
MNDPVQSRSDTREAAQPAVAHDEFAALLQKEFKPKTAEARESVERAVRTLAQQALEHTVGMTTDAYGSVK
QIIAEIDRKLSEQINQILHHNEFQTLEGAWRGLHYLVTHTETDELLKIKALPASRNEVARMLKRYKGVAW
DQSPLFRKIYEEEYGQFGGEPFGCLVGDFHFNHSPPDVEMLGELSKIAAAAHAPFIAGASPELMQMDSWQ
ELSNPRDLTKIFQNTEYAAWRSLRQSEDSRYIGLAMPRFLARLPYGARTNPVDEFDFEEDTDAANHDRYT
WANSAYAMAANINRSFKQFGWCSSIRGVESGGAVEGLPSHTFPTDDGGVDQKCPTEIAISDRREAELAKN
GFMPFVHRKNSDFAAFIGAQSLYQPAEYHDPDATANARLSGRLPYLFACCRFAHYLKCIVRDKIGSFRER
DDMERWLNDWIMNYVDGDPINSSQETKARKPLAAAQVVVDEVEDNPGYYTSKFFLRPHYQLEGLTVSLRL
ISRLPTAKAANE
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|78060853|ref|NC_007511.1|:c1804797-1803289 Burkholderia sp. 383 chromosome 2, complete sequence
ATGAATGATCCCGTCCAGTCCCGCTCGGACACACGCGAGGCCGCGCAACCGGCCGTCGCGCACGACGAAT
TTGCCGCGCTACTGCAGAAGGAATTCAAGCCGAAGACGGCCGAGGCGCGCGAGTCGGTCGAGCGCGCGGT
GCGCACGCTTGCGCAGCAGGCGCTCGAACATACGGTCGGCATGACGACCGATGCGTACGGCAGCGTGAAG
CAGATCATCGCGGAAATCGATCGCAAGCTGTCCGAGCAGATCAACCAGATCCTGCATCACAACGAATTCC
AGACGCTCGAAGGTGCGTGGCGCGGGCTCCATTACCTCGTCACGCACACCGAGACCGACGAGCTGCTGAA
GATCAAGGCCTTGCCGGCGTCGCGCAACGAGGTCGCGCGGATGCTGAAGCGCTACAAGGGCGTTGCATGG
GACCAGAGCCCGCTGTTCCGCAAGATCTACGAAGAGGAATACGGGCAGTTCGGCGGCGAGCCGTTCGGCT
GCCTGGTCGGCGATTTCCATTTCAACCACAGCCCGCCGGACGTCGAGATGCTCGGCGAGCTGTCGAAGAT
CGCTGCGGCCGCGCACGCGCCGTTCATCGCCGGCGCGTCGCCGGAACTGATGCAGATGGATTCGTGGCAG
GAGCTGTCGAACCCGCGCGACCTGACGAAGATCTTCCAGAACACCGAATACGCGGCGTGGCGCAGCCTGC
GGCAGTCGGAGGATTCGCGCTACATCGGCCTCGCGATGCCGCGCTTTCTCGCGCGGCTGCCGTACGGCGC
GCGCACCAACCCGGTCGACGAATTCGACTTCGAGGAAGACACCGATGCCGCGAACCACGACCGCTACACG
TGGGCGAACTCGGCATACGCGATGGCCGCGAACATCAACCGCTCGTTCAAGCAGTTCGGCTGGTGTTCGT
CGATCCGCGGCGTCGAATCGGGCGGGGCGGTCGAAGGGCTGCCGAGCCACACGTTCCCGACCGACGACGG
CGGCGTCGACCAGAAATGCCCGACCGAGATCGCGATCAGCGACCGCCGCGAGGCCGAGCTCGCGAAGAAC
GGCTTCATGCCGTTCGTACACCGGAAGAACTCGGATTTCGCGGCGTTCATCGGCGCGCAGTCGCTGTACC
AGCCGGCCGAATACCACGATCCCGACGCAACCGCGAACGCGCGGCTGTCCGGGCGCCTGCCGTACCTGTT
CGCGTGCTGCCGCTTCGCGCATTACCTGAAGTGCATCGTGCGCGACAAGATCGGCTCGTTCCGCGAACGC
GACGACATGGAGCGCTGGCTGAACGACTGGATCATGAACTACGTCGATGGCGACCCCATCAATTCGTCGC
AGGAAACCAAGGCGCGCAAGCCGCTTGCGGCCGCGCAGGTGGTCGTCGACGAGGTCGAGGACAACCCCGG
CTACTACACGTCGAAATTCTTCCTGCGGCCGCACTACCAGCTCGAAGGGCTCACGGTGTCGCTGCGGCTC
ATCTCGCGGCTGCCGACCGCGAAGGCGGCCAACGAGTGA