SecReT6
Protein ID: 78062438
SecReT6 ID106
T6SS typei3
Gene symbol-
Locus tagBcep18194_B1588
StrainBurkholderia sp. 383
Repliconchromosome 2 [GenBank: NC_007511] [Browse all T6SS(s) in this replicon]
Location [Strand]1804790..1805344 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ396A9
KEGG IDbur:Bcep18194_B1588
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.10E-58, Aligned region: 15..166
Protein Sequence: 184 a.a.     [Download]
>gi|78062438|ref|YP_372346.1| hypothetical protein Bcep18194_B1588 [Burkholderia sp. 383]
MTDRTKAAGSGQKFIARNRAPRVQIEYDVETYGAERKVQLPFVMGVISDLAGKRAEPLPDLPERKFLEID
VDNFDERMKSVAPRVAFQVPNTLTGEGMLNVDMTFEQIDDFSPAAIARNVDALRRLLEARTELSNLLSYM
DGKHGAEQLIERAINDPDLLKTLVRNPHEPAQGGDATQPEARDE
 
Nucleotide Sequence: 555 bp     [Download]
>gi|78060853|ref|NC_007511.1|:c1805344-1804790 Burkholderia sp. 383 chromosome 2, complete sequence
ATGACGGACAGAACCAAGGCGGCAGGCAGCGGACAGAAGTTCATCGCGCGCAATCGGGCGCCGCGCGTGC
AGATCGAGTACGACGTCGAGACCTACGGCGCCGAACGCAAGGTGCAGTTGCCGTTCGTGATGGGCGTGAT
CTCGGACCTGGCGGGCAAGCGCGCCGAGCCGTTGCCGGACTTGCCGGAGCGAAAGTTTCTCGAGATCGAC
GTCGACAACTTCGACGAGCGGATGAAATCGGTCGCGCCGCGCGTCGCGTTCCAGGTGCCGAACACGCTGA
CGGGCGAAGGGATGCTCAACGTCGACATGACGTTCGAGCAGATCGACGATTTCTCGCCGGCCGCGATCGC
GCGCAACGTCGACGCGCTGCGCCGGCTGCTGGAGGCGCGCACCGAGCTGTCGAACCTGCTGTCGTACATG
GACGGCAAGCACGGCGCCGAGCAGCTGATCGAGCGCGCGATCAACGATCCCGACCTGCTGAAGACCCTCG
TGCGCAACCCGCACGAGCCCGCACAGGGCGGCGACGCGACCCAACCGGAGGCCCGCGATGAATGA