SecReT6
Protein ID: 78062439
SecReT6 ID106
T6SS typei3
Gene symbol-
Locus tagBcep18194_B1589
StrainBurkholderia sp. 383
Repliconchromosome 2 [GenBank: NC_007511] [Browse all T6SS(s) in this replicon]
Location [Strand]1805418..1806533 [-]
ProductImpA-like
NoteTssA
UniProt IDQ396A8
KEGG IDbur:Bcep18194_B1589
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.80E-21, Aligned region: 81..141
ImpA-rel_N [PF06812], Evalue: 4.80E-21, Aligned region: 208..229
Protein Sequence: 371 a.a.     [Download]
>gi|78062439|ref|YP_372347.1| ImpA-like [Burkholderia sp. 383]
MHSNDVSQAALAAAALSTVPPGLPATPRADLIGQLLAEVAPDAPCGANLEYDAEFLQLQERATPRAEQQY
GDTVIPAEAPDWRAVERLALALSARTKDLRVIACLARSWTEQHGIPGYADALALVANLLARCWDDLHPRL
DADGDPDPTLRMNALAEMAGAHDCARAARRQPLFDGGPSVRDAERLLDGRDDTGSPVAGSRESLLAALSA
TRSDGTTPLDAARAALHALEAIRVCVTDKLGREWAPDEGDAEKALQRIVREVPLPEPQQVSPDLQQAAPG
DASQAGTTATAPTAMPNAHAWRDAEVTSRDDVRIGLDKMCRYFEQHEPSHPAPLLLRRAQRLLTLDFYEI
IRDLAPESLPKLDLLSGERSE
 
Nucleotide Sequence: 1116 bp     [Download]
>gi|78060853|ref|NC_007511.1|:c1806533-1805418 Burkholderia sp. 383 chromosome 2, complete sequence
ATGCATTCGAATGACGTCAGCCAGGCGGCGCTGGCCGCCGCCGCATTGTCCACGGTGCCGCCCGGCCTGC
CGGCGACCCCGCGCGCCGACCTGATCGGCCAGCTGCTCGCGGAGGTCGCGCCCGATGCGCCGTGCGGCGC
GAACCTCGAATACGACGCCGAGTTCCTGCAACTGCAGGAGCGCGCGACGCCGCGCGCCGAGCAGCAATAC
GGCGACACGGTGATCCCGGCCGAGGCGCCCGACTGGCGTGCGGTCGAGCGGCTCGCGCTTGCGCTGTCCG
CGCGCACGAAGGATCTGCGCGTCATCGCCTGTCTCGCGCGAAGCTGGACCGAGCAACACGGCATTCCCGG
CTATGCGGACGCGCTCGCGCTTGTCGCGAACCTGCTCGCGCGCTGCTGGGACGACCTGCATCCGCGGCTC
GACGCGGACGGCGACCCGGACCCGACGCTGCGTATGAACGCGCTCGCCGAGATGGCCGGCGCGCACGACT
GCGCGCGCGCGGCGCGCCGCCAGCCGCTGTTCGACGGCGGGCCGAGCGTGCGCGACGCGGAACGGCTGCT
CGACGGCCGCGACGATACCGGCAGCCCCGTGGCGGGCAGCCGCGAAAGCCTGCTGGCTGCGCTGTCGGCT
ACGCGTAGCGACGGCACGACGCCGCTCGACGCGGCGCGCGCGGCATTGCACGCGCTGGAGGCGATCCGCG
TGTGCGTGACGGACAAACTGGGCCGTGAATGGGCACCCGACGAAGGCGATGCGGAGAAAGCGCTGCAGCG
GATCGTGCGCGAAGTGCCGCTGCCGGAGCCGCAACAGGTGTCGCCCGACCTGCAGCAGGCCGCGCCCGGC
GACGCATCGCAGGCAGGCACGACAGCTACCGCGCCAACAGCAATGCCGAACGCCCACGCCTGGCGCGATG
CCGAGGTCACGAGCCGCGACGACGTGCGCATCGGTCTCGACAAGATGTGCCGCTATTTCGAGCAGCACGA
ACCGAGCCACCCGGCGCCGTTGCTGCTGCGGCGCGCCCAGCGGCTGCTCACGCTCGACTTCTACGAAATC
ATCCGCGATCTCGCACCGGAGAGCCTGCCGAAGCTGGACCTGCTGAGCGGCGAGCGGAGCGAATGA