SecReT6
Protein ID: 78062443
SecReT6 ID106
T6SS typei3
Gene symbol-
Locus tagBcep18194_B1593
StrainBurkholderia sp. 383
Repliconchromosome 2 [GenBank: NC_007511] [Browse all T6SS(s) in this replicon]
Location [Strand]1813216..1814538 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ396A4
KEGG IDbur:Bcep18194_B1593
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.10E-74, Aligned region: 49..253
DUF2077 [PF09850], Evalue: 4.10E-74, Aligned region: 395..426
OmpA [PF00691], Evalue: 1.60E-13, Aligned region: 250..259
OmpA [PF00691], Evalue: 1.60E-13, Aligned region: 318..416
Protein Sequence: 440 a.a.     [Download]
>gi|78062443|ref|YP_372351.1| hypothetical protein Bcep18194_B1593 [Burkholderia sp. 383]
MNSSSDSISPGTGGFVPPNPGGMHPAAAGAAGPTATQPRPGRWAASGTNPLVAAANPLLNLVPQIRSTVH
HPNPAWLREHLVVEIRQFEARAQEAGVPSEAIIGARYCLCTALDEAAALTPWGGSVWSSHSLLVSFHNET
WGGEKFFHLLERLSQQPRQHLDLLELLYFCLALGFEGRYRVLDNGHAQLDALRHQLALTIRSVRGEFEPA
LSPHWRDVVTRDVARRFVVPLWVCVALALLIGFGVFVGLRIALAGHSDRLFASIDALHVPKLQPAQAPPR
PAPAPRIAKFLEPEIAAGLVSVRDDADRSVIVLRGDGLFKSGSTSVIDRYVPVLARVADALNKVPGNVRV
TGYTDDTPVHTARFASNWDLSRERAEAVRGMIAARLDHPERLAAEGRGTLDPVAPNDSPANRALNRRVEI
TLLPAPGSAAVGASATQGAN
 
Nucleotide Sequence: 1323 bp     [Download]
>gi|78060853|ref|NC_007511.1|:c1814538-1813216 Burkholderia sp. 383 chromosome 2, complete sequence
ATGAATTCCTCCTCCGATTCGATCTCCCCCGGCACCGGCGGATTCGTGCCGCCGAATCCGGGCGGCATGC
ATCCGGCCGCGGCGGGCGCGGCCGGCCCGACCGCGACGCAGCCGCGCCCCGGGCGCTGGGCCGCGAGCGG
AACGAACCCGCTCGTCGCGGCCGCGAATCCGTTGCTCAACCTGGTGCCGCAGATCCGCTCGACCGTCCAT
CACCCGAATCCGGCGTGGCTGCGCGAGCATCTGGTCGTCGAGATCCGGCAGTTCGAGGCCCGTGCGCAGG
AAGCCGGCGTGCCGTCGGAAGCGATCATCGGCGCGCGCTACTGCCTGTGCACGGCGCTCGACGAGGCCGC
CGCGTTGACACCGTGGGGCGGCAGCGTCTGGTCGTCGCACAGCCTGCTCGTGTCGTTCCACAACGAAACG
TGGGGCGGCGAGAAATTCTTCCACCTGCTCGAACGCCTGTCGCAGCAGCCGCGCCAGCATCTCGACCTGC
TCGAGCTGCTGTATTTCTGTCTCGCGCTCGGCTTCGAGGGCCGCTATCGGGTGCTCGACAACGGCCATGC
GCAGCTCGACGCGCTGCGCCACCAGCTCGCGCTGACGATCCGCTCGGTGCGCGGCGAATTCGAGCCGGCG
CTGTCGCCGCACTGGCGCGACGTCGTCACGCGCGATGTCGCGCGCCGGTTCGTCGTGCCGCTGTGGGTCT
GCGTGGCGCTCGCGCTGCTGATCGGCTTCGGCGTGTTCGTCGGGCTGCGCATTGCGCTCGCCGGGCATTC
GGATCGGCTGTTCGCGTCGATCGACGCGCTGCACGTGCCGAAGCTGCAACCCGCACAGGCGCCACCGCGC
CCGGCACCGGCGCCGCGCATCGCGAAGTTCCTGGAACCGGAGATCGCGGCCGGCCTCGTATCGGTGCGCG
ACGACGCCGATCGGAGCGTGATCGTGCTGCGCGGCGACGGGTTGTTCAAGTCCGGCTCGACGTCGGTGAT
CGACCGCTACGTGCCGGTGCTCGCGCGGGTGGCCGACGCACTGAACAAGGTGCCCGGCAACGTGCGGGTG
ACCGGCTATACCGACGACACGCCCGTGCATACGGCGCGCTTCGCGTCGAACTGGGACCTGTCGCGCGAAC
GCGCGGAAGCCGTGCGCGGGATGATCGCCGCGCGGCTCGACCATCCGGAACGGCTCGCGGCGGAAGGGCG
CGGCACGCTCGACCCGGTCGCACCGAACGATTCGCCGGCGAACCGCGCGCTGAACCGGCGCGTCGAGATC
ACGCTGCTGCCGGCGCCCGGCAGTGCCGCCGTCGGCGCGAGCGCCACGCAGGGAGCCAACTGA