SecReT6
Protein ID: 78062444
SecReT6 ID106
T6SS typei3
Gene symbol-
Locus tagBcep18194_B1594
StrainBurkholderia sp. 383
Repliconchromosome 2 [GenBank: NC_007511] [Browse all T6SS(s) in this replicon]
Location [Strand]1814554..1815972 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ396A3
KEGG IDbur:Bcep18194_B1594
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.40E-158, Aligned region: 30..471
Protein Sequence: 472 a.a.     [Download]
>gi|78062444|ref|YP_372352.1| hypothetical protein Bcep18194_B1594 [Burkholderia sp. 383]
MTEPTMSATPVAALRQRVVWTEGMFLRPQHFQQLERHWERYVALRCLPLQGFYWGFDTLELDREQLALGK
VALRTASGVMRDGTPFDLSHPDDLPEPLDVPADAKDQLVVLALPLWRGGGEEVSFGAGAGAGSGNAANGA
NGANSGADVARYVVREYEVADANAVALGPALLQTGRLNVRLMLEAELTGDWHALGVARIVERRTDARLLV
DDGYIPPRLVAQHDTVLLAYARELHGLLTQRSEALAERLSEPGRGGVSEVADFLLLQLVNRYLALTWHAQ
QHVSTHPESLFCDWLKLACDLSTFTAAGRRPQSLAVYVHDDLRTSFAELMTELRRSLSTVLEQNAIQIEL
RDAGNGIRVATLADPALRDTAGFVLAVRADVPADSLRARFPAQAKLGPVERIRDLVQLQLPGITMRQLPV
APRQIPYHAGHTYFEIDKGSDLWKQLARSGGLAFHFAGEFPGLSMEFWAIRG
 
Nucleotide Sequence: 1419 bp     [Download]
>gi|78060853|ref|NC_007511.1|:c1815972-1814554 Burkholderia sp. 383 chromosome 2, complete sequence
ATGACCGAACCGACGATGTCCGCGACGCCGGTCGCGGCGCTCCGCCAGCGGGTGGTGTGGACCGAGGGGA
TGTTCCTGCGGCCGCAGCATTTCCAGCAGCTCGAACGGCACTGGGAGCGCTACGTCGCGTTGCGCTGCCT
GCCGCTGCAAGGCTTCTACTGGGGCTTCGACACGCTGGAGCTCGATCGCGAGCAACTGGCGCTCGGCAAG
GTCGCGCTGCGCACCGCGTCGGGCGTGATGCGCGACGGCACGCCGTTCGACCTGTCCCATCCGGACGATC
TCCCCGAACCGCTCGACGTACCGGCCGATGCGAAGGACCAGCTCGTCGTGCTCGCGCTGCCGCTGTGGCG
CGGCGGCGGCGAGGAGGTGTCGTTCGGCGCGGGTGCGGGTGCAGGCAGCGGCAATGCCGCGAACGGTGCA
AATGGCGCGAACAGCGGTGCCGATGTCGCACGCTACGTCGTGCGCGAATACGAAGTGGCCGACGCGAACG
CGGTCGCGCTCGGCCCCGCGCTGCTGCAAACGGGACGCCTGAACGTGCGGCTGATGCTGGAGGCCGAACT
GACCGGCGACTGGCACGCGCTCGGCGTTGCGCGAATCGTCGAACGGCGCACCGATGCGCGGCTACTCGTC
GACGACGGCTACATTCCGCCGCGCCTCGTCGCGCAGCACGACACCGTGCTGCTGGCCTATGCGCGCGAGC
TGCACGGGTTGCTCACGCAACGCAGCGAAGCGCTCGCGGAACGGCTGTCGGAGCCCGGGCGCGGCGGCGT
GTCGGAAGTCGCGGATTTCCTGCTGCTGCAGCTCGTGAACCGCTATCTCGCGCTGACCTGGCATGCGCAG
CAGCACGTGTCGACGCACCCGGAGTCGCTGTTCTGCGACTGGCTGAAGCTCGCGTGCGACCTGAGCACGT
TCACGGCGGCCGGCCGGCGCCCTCAGTCGCTCGCGGTCTACGTCCACGACGACCTGCGCACGAGCTTCGC
GGAGCTGATGACCGAGCTGCGCCGGTCGCTGTCGACGGTGCTCGAACAAAACGCGATCCAGATCGAGCTG
CGCGATGCGGGCAACGGCATCCGCGTCGCGACGCTGGCCGACCCGGCGCTGCGCGACACGGCCGGCTTCG
TGCTCGCGGTGCGCGCGGACGTGCCGGCCGACAGCCTGCGCGCGCGGTTTCCCGCGCAGGCGAAGCTCGG
GCCGGTCGAACGGATCCGCGATCTCGTGCAGTTGCAGCTGCCGGGCATCACGATGCGCCAGTTGCCGGTC
GCGCCGCGGCAGATCCCGTATCACGCGGGCCATACGTACTTCGAGATCGACAAGGGCAGCGACCTGTGGA
AGCAACTGGCGCGCTCCGGTGGTCTCGCTTTTCATTTCGCCGGCGAATTCCCTGGGCTCTCGATGGAGTT
CTGGGCGATACGCGGGTAA