SecReT6
Protein ID: 78062445
SecReT6 ID106
T6SS typei3
Gene symbol-
Locus tagBcep18194_B1595
StrainBurkholderia sp. 383
Repliconchromosome 2 [GenBank: NC_007511] [Browse all T6SS(s) in this replicon]
Location [Strand]1815969..1816484 [-]
Producthypothetical protein
NoteTssJ
UniProt IDQ396A2
KEGG IDbur:Bcep18194_B1595
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.00E-36, Aligned region: 15..160
Protein Sequence: 171 a.a.     [Download]
>gi|78062445|ref|YP_372353.1| hypothetical protein Bcep18194_B1595 [Burkholderia sp. 383]
MQWRSSSFIVWGCVMLLPGCGATEHAAAVPYAITVDVAPDVNPDMNRKPSPIVLKVFQLRAASSFDSADF
FSLQDKPENVLGADLLGTDRVILRPGESRTLHYRGNVEAGAIGVVAEYRMLEKNRWRLTVPLPRAKQLNL
YKFWQTSPGELKLSIAVRNGGIALNDAKGRP
 
Nucleotide Sequence: 516 bp     [Download]
>gi|78060853|ref|NC_007511.1|:c1816484-1815969 Burkholderia sp. 383 chromosome 2, complete sequence
ATGCAATGGCGGTCGAGCAGTTTCATCGTATGGGGATGCGTGATGCTGTTGCCGGGGTGCGGTGCGACGG
AGCACGCCGCGGCGGTGCCGTATGCGATCACGGTTGACGTCGCGCCCGACGTCAACCCGGACATGAACCG
CAAGCCTTCGCCGATCGTGCTGAAGGTGTTCCAGCTCCGCGCGGCGTCGTCGTTCGACAGCGCGGACTTC
TTCTCGCTGCAGGACAAGCCGGAAAACGTGCTCGGCGCGGACCTGCTGGGCACCGACCGCGTGATCCTGC
GGCCGGGCGAGTCGCGCACGCTGCACTATCGCGGCAACGTCGAGGCCGGCGCGATCGGCGTGGTCGCCGA
ATACCGCATGCTCGAAAAGAACCGCTGGCGGCTGACAGTGCCGCTGCCGCGCGCAAAGCAGCTCAATCTC
TACAAGTTCTGGCAGACGTCGCCGGGCGAACTGAAGCTGTCGATCGCCGTACGCAATGGCGGCATCGCAC
TGAACGATGCGAAGGGGCGCCCATGA