SecReT6
Protein ID: 78062447
SecReT6 ID106
T6SS typei3
Gene symbol-
Locus tagBcep18194_B1597
StrainBurkholderia sp. 383
Repliconchromosome 2 [GenBank: NC_007511] [Browse all T6SS(s) in this replicon]
Location [Strand]1817546..1819003 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDQ396A0
KEGG IDbur:Bcep18194_B1597
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 5.90E-10, Aligned region: 29..96
Protein Sequence: 485 a.a.     [Download]
>gi|78062447|ref|YP_372355.1| FHA domain-containing protein [Burkholderia sp. 383]
MQLIVIEHAGEPVENDSYDAVVFHPPGGTIGRASDNHLVLRDDTRQISRLQALLQVGDDACLLKNLSSVS
TIEVNREPVGYAQERPLNTGDIIRIGPYVLRAERDDGGDGDQAPVIDMATGTGAHADPQPQAHASAAPAQ
ASASRIDTKGAGNRLWGLLQDRLAPRGKAADTGTRPGGPARADAAQPANRAAQTVPPSPSQRDLNQLSID
PLDLFAQSSGDIGTSGTSGTASQVDRGSASREASSTTQADHAPEWTQHVRVQPAAARAADAQPADEPAPH
APRAPTPDELLSAFFEGAGLDTAAESHQWSAEQLYIAGQLLALFANGTVELLSSRSILKREVKAHMTMLL
DRENNPLKLLPDGGAVLRQMFGLPLPGFMSPQSAVSDAFQDLHAHQIGMVAGMRAALMDLLTRFSPQRLR
ERDDAMRWYEKRVPVLYKARMWDRYAATHRDTVFAIEDDFASVFGKAFLAAYDAEVESYRGSGRH
 
Nucleotide Sequence: 1458 bp     [Download]
>gi|78060853|ref|NC_007511.1|:1817546-1819003 Burkholderia sp. 383 chromosome 2, complete sequence
ATGCAACTGATCGTGATCGAACATGCCGGCGAGCCGGTCGAAAACGACTCCTACGACGCCGTCGTGTTTC
ATCCGCCGGGCGGCACCATCGGCCGGGCCAGCGACAACCATCTCGTGTTGCGCGACGACACACGGCAGAT
TTCGCGGCTGCAGGCGCTGCTGCAGGTCGGCGACGACGCGTGCCTGCTAAAGAACCTGAGCAGCGTATCG
ACGATCGAGGTGAACCGCGAGCCGGTCGGCTATGCGCAGGAGCGCCCGCTCAACACCGGCGACATCATCC
GCATCGGGCCGTACGTGCTGCGCGCCGAACGTGACGACGGCGGCGATGGCGACCAGGCACCGGTCATCGA
CATGGCGACCGGTACCGGCGCGCACGCCGATCCGCAGCCGCAGGCACACGCGTCAGCGGCCCCCGCACAA
GCATCGGCTTCGCGGATCGATACGAAAGGCGCCGGCAACCGGCTGTGGGGGCTACTCCAGGATCGTCTCG
CGCCGCGCGGCAAGGCGGCGGACACCGGCACACGGCCAGGTGGCCCCGCACGTGCGGACGCCGCCCAGCC
GGCGAACCGCGCAGCGCAGACCGTCCCGCCCTCACCCTCGCAGCGCGACTTGAACCAGTTGTCGATCGAT
CCGCTCGACCTGTTCGCGCAGTCGTCGGGCGATATCGGTACGTCGGGCACGTCGGGCACGGCGTCGCAAG
TCGATCGTGGCAGCGCCAGTCGCGAAGCGTCGTCCACGACCCAGGCCGACCATGCGCCCGAGTGGACGCA
GCACGTGCGTGTGCAGCCAGCCGCCGCGCGCGCCGCCGATGCGCAGCCGGCCGACGAACCGGCGCCGCAT
GCGCCGCGCGCGCCGACGCCCGATGAGCTGCTGAGCGCGTTCTTCGAAGGCGCGGGGCTCGATACGGCCG
CCGAGTCGCATCAGTGGTCGGCCGAACAGCTGTACATCGCGGGCCAGTTGCTGGCGCTGTTCGCGAACGG
CACGGTCGAGCTGCTGTCGTCGCGCAGCATCCTGAAGCGCGAGGTCAAGGCGCACATGACGATGCTGCTC
GATCGCGAGAACAACCCGCTGAAGCTGCTGCCGGACGGCGGCGCCGTGCTGCGGCAGATGTTCGGGCTGC
CGCTGCCGGGCTTCATGTCGCCGCAGAGCGCGGTGAGCGACGCGTTCCAGGATCTGCACGCGCACCAGAT
CGGCATGGTCGCCGGCATGCGCGCCGCGTTGATGGACCTGCTGACGCGCTTTTCACCGCAACGCCTGCGC
GAGCGCGACGACGCGATGCGCTGGTACGAGAAGCGCGTGCCCGTGCTGTACAAGGCGAGGATGTGGGATC
GCTACGCGGCGACCCATCGCGACACGGTGTTCGCGATCGAAGACGATTTCGCGTCGGTGTTCGGCAAGGC
GTTCCTGGCCGCGTACGACGCGGAAGTGGAAAGCTACCGCGGCAGCGGCCGGCATTGA