SecReT6
Protein ID: 78065026
SecReT6 ID104
T6SS typei4b
Gene symbol-
Locus tagBcep18194_A3549
StrainBurkholderia sp. 383
Repliconchromosome 1 [GenBank: NC_007510] [Browse all T6SS(s) in this replicon]
Location [Strand]410920..414144 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ39K65
KEGG IDbur:Bcep18194_A3549
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.60E-70, Aligned region: 57..368
Phage_GPD [PF05954], Evalue: 1.60E-70, Aligned region: 600..661
DUF2345 [PF10106], Evalue: 1.20E-59, Aligned region: 683..835
DUF2345 [PF10106], Evalue: 1.20E-59, Aligned region: 1022..1055
T6SS_Vgr [PF13296], Evalue: 1.50E-36, Aligned region: 1..28
T6SS_Vgr [PF13296], Evalue: 1.50E-36, Aligned region: 539..645
T6SS_Vgr [PF13296], Evalue: 1.50E-36, Aligned region: 1021..1063
Phage_base_V [PF04717], Evalue: 1.50E-20, Aligned region: 439..529
Phage_base_V [PF04717], Evalue: 1.50E-20, Aligned region: 896..923
Sarcoglycan_1 [PF04790], Evalue: 0.0024, Aligned region: 729..800
Protein Sequence: 1074 a.a.     [Download]
>gi|78065026|ref|YP_367795.1| unnamed protein product [Burkholderia sp. 383]
MLVPSEGASKEKRPFMNMQNTIAALSGGLLQQDRLLKLDTPLGANVLTVQRAVGRSRIGRAYEFTLDVLS
TDSDVELKKLIAQPVTLWIQQGDLGYRPVNGYVHTARRLGADGGLTTYQLAFADFTHFLKFRRDQRLWND
TTVDQIISDVLNQHPQAQGHFRFALTKPLPNRSYTRQHDTDWHFVHRLMESEGLYCAWQQADDGKSHTLV
ITDNLQAFAPLSPEAVRFYRGGAASEADAFTQWSGTRMLQSVTRTTRTFDYKNPSQPSNPKGTSLPTMGG
QGELPDQLEVYEYTGGYTYLDQTRGDHLTKVKMEAWESQAKRFHGAGGVRAIDAGRRFTLADHPEHDRDP
ADQREFAAIEVAWWIENNLPVASDSADFPYSLREALTQAQDNYGADPAFRVQHDDGSAGFYLVEVEAQRV
SVPYRSPFEHHKPEMHLETAIVVGPQGEEVYTDTLNRIRVQFVWDRMNPGNENASCWVRVVQSDTGGGYG
GVHVPRIGEEVLIDYVGGDCDRPLAVGRVYNGANQPQWHTDGILSGYRSKEYSGSGYNQLVMDDATGQNR
VQLMSSSANSLLHLGYLIDHNANSRGSYLGSGFDLRSDAYGAVRASQGLYVTTHPKAANSQPLDVREAQQ
QLVTGETLVEAMSGASEQHQAESLKDAQDTMRAFTDATQDSASGSASGGRTAGGGTGNANAFKEPVMLFG
SPSGIGMSTQQSVHVVANDHVNVASGQSVHVAAGKSLIGSIGQKLSLFVQNAGMKLFAGKGKVEIQAQSD
NVEVTAQKTVKVVSSTDRIEIAADQGILLTSGGGYVRIQGGNIEIHTPGAVDVKGASHTFAGPASMGYPL
PSPRPDQPGQLELLHTYGNGQPVKGGLFSVFDANGGLLKKGALDNNGHMIVSGLPPGAVQVKFGEDPRSQ
DQQASRFDVAPWPANPAPAAGAAETAQAQLGSFLPAAGGAAGALTGLAGAATQGGAALAKAAVGQGMGMA
QQALVGMLPAGASNALGAAKTVAGLASSASQGGAALAKAVAGQGLGIAQQAAANMLPAGAQAALSHAGQL
SAAAQQVSGLAQTARSAAAALKMS
 
Nucleotide Sequence: 3225 bp     [Download]
>gi|78064658|ref|NC_007510.1|:410920-414144 Burkholderia sp. 383 chromosome 1, complete sequence
ATGCTCGTGCCATCCGAGGGCGCGTCAAAAGAAAAAAGGCCGTTCATGAACATGCAGAACACAATCGCCG
CCTTGAGCGGCGGATTGCTTCAGCAGGACCGGTTGCTGAAGCTCGATACGCCATTGGGTGCCAACGTCCT
GACCGTTCAGCGGGCGGTCGGCCGCTCGCGTATCGGGCGCGCGTACGAGTTCACGCTCGACGTGCTGTCG
ACCGACAGCGATGTGGAACTTAAAAAGCTGATCGCACAGCCGGTGACGTTGTGGATCCAGCAGGGCGATC
TCGGCTACCGGCCAGTCAACGGATATGTGCATACCGCACGCCGGCTGGGCGCCGACGGCGGGCTCACGAC
CTATCAGCTCGCGTTCGCGGATTTCACCCATTTCCTGAAGTTCCGTCGCGATCAGCGGCTCTGGAACGAC
ACGACCGTCGACCAGATCATCAGCGATGTGCTGAACCAGCATCCGCAGGCCCAGGGCCATTTCCGCTTTG
CGCTGACGAAGCCGCTGCCGAACCGCTCCTACACACGCCAGCACGACACCGACTGGCATTTCGTGCATCG
GCTGATGGAGAGCGAGGGGCTCTACTGCGCATGGCAGCAGGCCGACGACGGCAAGTCGCATACGCTCGTC
ATCACCGACAACCTGCAGGCGTTCGCGCCGCTGTCGCCGGAAGCCGTGCGCTTTTATCGCGGCGGCGCGG
CCAGCGAAGCCGACGCGTTCACGCAATGGTCGGGTACGCGCATGCTGCAGAGCGTGACCCGCACGACGCG
CACGTTCGACTACAAGAATCCTTCGCAGCCGTCGAACCCGAAAGGCACGTCGCTGCCGACGATGGGCGGC
CAGGGCGAGTTGCCGGATCAACTCGAAGTCTACGAGTACACGGGCGGCTACACGTATCTCGACCAGACGC
GCGGTGACCATCTGACGAAGGTCAAGATGGAGGCGTGGGAGTCGCAAGCGAAGCGTTTCCATGGCGCGGG
CGGCGTGCGTGCGATCGATGCCGGCCGGCGCTTCACGCTGGCCGATCATCCCGAGCACGATCGTGATCCC
GCCGATCAGCGCGAGTTCGCCGCGATCGAGGTCGCGTGGTGGATCGAGAACAATCTGCCCGTCGCAAGCG
ACAGCGCGGACTTTCCGTACAGCCTGCGCGAAGCGTTGACGCAGGCACAGGACAACTACGGCGCCGATCC
TGCGTTTCGCGTTCAGCACGACGACGGTTCGGCCGGCTTCTATCTCGTCGAAGTCGAAGCGCAACGTGTG
AGCGTCCCGTATCGCAGCCCGTTCGAGCATCACAAGCCGGAGATGCACCTCGAGACCGCGATCGTCGTCG
GGCCGCAGGGCGAGGAAGTCTATACCGACACCCTGAACCGGATCCGCGTGCAGTTCGTGTGGGACCGGAT
GAACCCGGGTAACGAGAATGCATCGTGCTGGGTGCGCGTCGTGCAGTCGGATACGGGCGGTGGCTACGGC
GGCGTGCACGTGCCGCGCATCGGCGAGGAGGTGCTGATCGACTACGTCGGCGGCGACTGCGACCGGCCGC
TCGCGGTCGGGCGCGTGTACAACGGCGCGAACCAGCCGCAGTGGCATACCGACGGGATCCTGTCCGGGTA
TCGGTCGAAAGAGTATTCGGGCAGCGGCTACAACCAGCTCGTGATGGACGACGCGACCGGGCAAAACCGC
GTGCAGCTGATGAGCAGCAGCGCGAACAGCCTGCTGCATCTCGGCTACCTCATCGATCACAACGCCAATT
CGCGCGGGTCGTATCTCGGCAGCGGGTTCGACCTGCGTTCCGATGCGTATGGTGCGGTGCGGGCGAGCCA
GGGCCTGTACGTGACGACGCACCCGAAGGCAGCGAACAGCCAGCCGCTCGACGTGAGGGAAGCGCAGCAG
CAGCTCGTGACGGGCGAGACCCTCGTCGAGGCGATGTCGGGCGCGAGCGAGCAGCATCAGGCGGAAAGCC
TGAAGGACGCGCAGGACACGATGCGCGCGTTCACGGACGCGACACAGGACAGCGCATCGGGCAGCGCGTC
CGGCGGGCGTACGGCAGGCGGCGGCACGGGTAACGCGAACGCATTCAAGGAGCCGGTGATGCTGTTCGGC
AGCCCGTCGGGGATCGGGATGTCGACGCAGCAGTCGGTGCACGTGGTCGCGAACGATCACGTGAACGTGG
CGAGCGGGCAGAGCGTGCACGTTGCCGCAGGCAAGTCGCTGATCGGGAGCATCGGGCAGAAGCTGAGCCT
GTTCGTGCAGAACGCGGGGATGAAGCTGTTCGCGGGCAAGGGCAAGGTGGAGATCCAGGCGCAGTCGGAC
AACGTCGAGGTGACCGCGCAGAAGACGGTGAAGGTGGTGTCGTCGACGGACCGGATCGAGATCGCGGCCG
ATCAGGGGATTCTGCTGACGAGCGGCGGCGGGTATGTCCGCATCCAGGGCGGGAATATCGAGATCCATAC
GCCGGGGGCGGTGGATGTGAAGGGCGCGTCGCATACGTTCGCGGGGCCGGCGAGCATGGGGTATCCGTTG
CCGAGCCCGCGGCCGGATCAGCCGGGGCAGTTGGAGTTGTTGCATACGTACGGGAACGGCCAGCCGGTGA
AGGGCGGCTTGTTCTCGGTGTTCGATGCGAATGGCGGGCTGTTGAAGAAAGGGGCGCTCGACAACAACGG
GCACATGATCGTGAGTGGCCTGCCACCGGGGGCGGTGCAGGTGAAGTTCGGGGAGGATCCGCGCTCGCAG
GATCAACAGGCGAGCCGGTTCGATGTGGCGCCGTGGCCGGCCAATCCGGCGCCGGCGGCAGGCGCCGCGG
AAACCGCACAGGCGCAGCTCGGTTCGTTTCTGCCGGCAGCGGGTGGTGCAGCCGGCGCGCTGACGGGCCT
GGCCGGTGCGGCGACGCAGGGTGGAGCGGCGCTGGCGAAGGCCGCCGTTGGTCAAGGCATGGGCATGGCG
CAGCAGGCGCTGGTCGGCATGCTGCCGGCCGGCGCGTCGAATGCACTGGGTGCGGCGAAAACGGTCGCGG
GATTGGCGAGCTCGGCGTCGCAGGGCGGTGCTGCCCTTGCGAAGGCAGTGGCAGGCCAGGGCCTCGGTAT
CGCGCAGCAGGCTGCGGCCAACATGCTGCCGGCGGGGGCGCAGGCGGCGCTGTCGCACGCGGGCCAGTTG
AGTGCCGCCGCGCAGCAGGTCAGCGGTCTCGCGCAGACGGCGCGTAGCGCCGCCGCCGCGCTGAAAATGA
GCTGA