SecReT6
Protein ID: 78065031
SecReT6 ID104
T6SS typei4b
Gene symbol-
Locus tagBcep18194_A3555
StrainBurkholderia sp. 383
Repliconchromosome 1 [GenBank: NC_007510] [Browse all T6SS(s) in this replicon]
Location [Strand]420931..421713 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ39K60
KEGG IDbur:Bcep18194_A3555
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.70E-58, Aligned region: 30..231
Protein Sequence: 260 a.a.     [Download]
>gi|78065031|ref|YP_367800.1| unnamed protein product [Burkholderia sp. 383]
MSYAPSLFGDNAPAPLHTPASTDASFQARSLLDLLYDGFFMLFLLKNGREPESAGEFSTRIQEFLSDFER
GAKKLNIAAEDVYGAKFAFCAAIDEMVLSSQFKIRTDWERRPLQLVLFGEQLAGEKFFQYLEECRAQGAA
RLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARLGDEIAHMKGKRAPFAPHWPLPDQIAHRLKREVPVW
AIGAVFALVALLGYLGLNTYLKDKTLQALAPYSQVIKVGPESANLTISLP
 
Nucleotide Sequence: 783 bp     [Download]
>gi|78064658|ref|NC_007510.1|:c421713-420931 Burkholderia sp. 383 chromosome 1, complete sequence
ATGAGCTACGCGCCTTCCCTGTTCGGCGACAACGCGCCGGCACCGCTGCATACGCCCGCGTCGACCGACG
CCTCGTTCCAGGCCCGTTCGCTGCTCGACCTGCTGTACGACGGGTTCTTCATGCTGTTCCTGCTTAAGAA
CGGGCGGGAACCGGAGAGCGCGGGCGAATTCAGCACGCGGATCCAGGAATTCCTGTCGGATTTCGAGCGC
GGTGCGAAGAAGCTGAATATCGCGGCTGAAGACGTGTACGGCGCGAAGTTCGCGTTCTGCGCGGCGATCG
ACGAGATGGTGCTGTCGTCGCAGTTCAAGATCCGCACGGACTGGGAACGCCGGCCGCTGCAGCTCGTGCT
GTTCGGCGAGCAGCTCGCGGGCGAGAAGTTCTTCCAGTATCTCGAGGAATGTCGCGCGCAGGGCGCGGCG
CGGCTGCAGTCGCTCGAGGTGTTTCACATGTGCCTGCTGCTCGGGTTCCAGGGGAAGTATCTGCTGGAAG
GGCCGGAGAAGCTGGCTTACCTCACCGCGCGGCTGGGGGACGAGATCGCGCACATGAAGGGCAAGCGGGC
GCCGTTCGCGCCCCATTGGCCGCTGCCGGATCAGATCGCGCATCGGTTGAAGCGTGAGGTGCCGGTGTGG
GCGATTGGGGCGGTGTTCGCGCTCGTGGCGCTGCTCGGGTATCTCGGGCTCAACACGTACCTGAAGGACA
AGACGCTGCAGGCGTTGGCGCCTTATTCGCAGGTGATCAAGGTCGGGCCGGAGTCGGCTAATTTGACGAT
TTCGTTGCCTTGA