SecReT6
Protein ID: 78065032
SecReT6 ID104
T6SS typei4b
Gene symbol-
Locus tagBcep18194_A3556
StrainBurkholderia sp. 383
Repliconchromosome 1 [GenBank: NC_007510] [Browse all T6SS(s) in this replicon]
Location [Strand]421710..423056 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ39K59
KEGG IDbur:Bcep18194_A3556
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.50E-134, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|78065032|ref|YP_367801.1| unnamed protein product [Burkholderia sp. 383]
MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGVRSVRIDRDALGSNVLRVAELALVFP
DGALYAAPQADDLPPPIALDTLPDGINEFVFYLALHPLRENGTNYSDDPAAGFMTRFVSEQTSVGDNFTD
AAEADITFLKTQVKLIAHSEPRDQLLSVPLVRVRRTATSGFEIDDSFVPPCLAIDASPILHQRLRQLVDA
LQAKVNALYGFHREPSKNIIEFRSGDIASFWLLHTANAAFATLAHLHQHSALHPERLFQELLRLAGQLMT
FSKGYTLADLPVYRHDDPGPSFARLDLMLRELLDTVISTRYFAITLDEVRPSFHLGRLDSGKIDDKTEFY
LAVSADMPSVELVDAVPARFKVGAPDDVDKLVLSAMPGVRLSYTPQVPPAIPVRPGACYFALDSRGALYE
RMLQAQSAMIYAPTGINDLKFELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|78064658|ref|NC_007510.1|:c423056-421710 Burkholderia sp. 383 chromosome 1, complete sequence
ATGAGTTATTCGGCCAAGGTGCTGTGGGGGGAAGGGCTGTTCCTCCGGCCTCAACACTTTCAGCGACAGG
ACGCGTACCACGAAGCGCGCCTGTTCGAATCGATCCAGGCGATCCAGCCGTACAACTGGGGCGTGCGCTC
GGTGCGCATCGACCGCGATGCGCTCGGCAGCAACGTGCTGCGGGTAGCCGAGCTTGCGCTCGTGTTCCCG
GACGGCGCGCTGTATGCCGCGCCGCAGGCCGACGACCTGCCGCCGCCGATCGCGCTGGACACGCTGCCTG
ATGGCATCAACGAATTCGTGTTCTATCTCGCGCTGCACCCGCTGCGCGAGAACGGCACCAACTACAGCGA
CGATCCGGCCGCCGGCTTCATGACGCGCTTCGTCAGCGAGCAGACCAGCGTCGGCGACAACTTCACCGAC
GCGGCCGAAGCCGACATCACGTTCCTGAAGACGCAGGTCAAGCTGATCGCGCACAGCGAACCGCGCGACC
AGCTGCTGTCGGTGCCGCTCGTGCGTGTGCGCCGCACCGCGACGTCGGGTTTCGAGATCGACGACAGCTT
CGTGCCGCCGTGCCTCGCGATCGACGCGTCGCCGATCCTCCACCAGCGGCTGCGCCAGCTCGTCGACGCG
CTGCAGGCGAAGGTGAACGCGCTGTACGGCTTCCACCGTGAACCGTCGAAGAACATCATCGAGTTCCGCT
CGGGCGACATCGCGTCGTTCTGGCTGCTGCACACCGCAAACGCCGCGTTCGCGACGCTCGCGCACCTGCA
CCAGCATTCGGCGCTGCACCCGGAGCGGCTGTTCCAGGAACTGCTGCGCCTTGCGGGCCAGCTGATGACG
TTCTCGAAGGGCTACACGCTCGCCGACCTGCCGGTGTACCGCCACGACGATCCGGGCCCGAGCTTCGCGC
GTCTCGACCTGATGCTGCGCGAGCTGCTCGACACCGTGATCTCGACGCGCTACTTCGCGATCACGCTCGA
TGAGGTGCGCCCGTCGTTCCACCTCGGCCGCCTCGATTCCGGCAAGATCGACGACAAGACCGAGTTCTAC
CTGGCGGTGTCCGCGGACATGCCGAGCGTCGAGCTCGTCGATGCGGTGCCGGCCCGTTTCAAGGTCGGTG
CCCCCGACGACGTCGACAAGCTCGTGCTGTCGGCCATGCCCGGCGTGCGGCTCTCGTACACGCCGCAGGT
GCCGCCCGCGATTCCGGTGCGCCCGGGCGCCTGCTACTTCGCGCTCGATTCGCGTGGTGCGCTGTACGAG
CGCATGCTGCAGGCCCAGTCCGCGATGATCTACGCGCCGACTGGCATCAATGACCTGAAATTCGAACTGA
TCGCGGTCACATCATGA