SecReT6
Protein ID: 78065033
SecReT6 ID104
T6SS typei4b
Gene symbol-
Locus tagBcep18194_A3557
StrainBurkholderia sp. 383
Repliconchromosome 1 [GenBank: NC_007510] [Browse all T6SS(s) in this replicon]
Location [Strand]423160..423771 [-]
Producthypothetical protein
NoteTssJ
UniProt IDQ39K58
KEGG IDbur:Bcep18194_A3557
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.30E-37, Aligned region: 15..175
Protein Sequence: 203 a.a.     [Download]
>gi|78065033|ref|YP_367802.1| unnamed protein product [Burkholderia sp. 383]
MRSLMIRYALPLVACALLAGCAAAPLLGSAASAVMSAAGIGKPEVPDAQKPPRNLGITLAAAPNLNAATD
NKPLALVVRLYTLKDPTSFQQAPFDAFTDPTKEKAALGADLLNVREITLIPGQRYTATEKVSREAQAFGI
VALFRDPALQRWKLTFDPVKSEKSGIIIGLHNCAMTVTDGTVIAPQQGAPSQPLNLLSSVSCG
 
Nucleotide Sequence: 612 bp     [Download]
>gi|78064658|ref|NC_007510.1|:c423771-423160 Burkholderia sp. 383 chromosome 1, complete sequence
ATGAGATCGTTGATGATTCGCTACGCGCTGCCACTGGTTGCCTGCGCCCTTCTGGCCGGATGCGCGGCCG
CCCCGCTGCTCGGCTCGGCCGCGAGCGCCGTGATGTCCGCGGCCGGGATCGGCAAGCCCGAGGTGCCCGA
CGCGCAGAAGCCGCCGCGCAACCTCGGCATCACGCTCGCCGCGGCGCCGAACCTGAACGCCGCGACCGAC
AACAAGCCGCTCGCGCTCGTCGTGCGGCTCTATACGCTGAAGGACCCGACATCGTTCCAGCAGGCGCCGT
TCGATGCCTTTACGGATCCGACCAAGGAAAAGGCCGCGCTGGGCGCCGACCTGCTGAACGTGCGTGAAAT
CACGCTGATTCCGGGCCAGCGCTATACGGCGACCGAGAAGGTTTCGCGCGAAGCGCAGGCATTCGGCATC
GTCGCGCTGTTCCGCGATCCCGCACTACAACGATGGAAACTGACGTTCGATCCGGTGAAGTCGGAGAAAT
CCGGCATAATCATCGGCCTGCATAATTGCGCGATGACGGTCACCGACGGCACTGTCATCGCACCGCAACA
GGGTGCGCCTTCGCAACCGCTGAATTTGCTTTCTTCGGTCTCCTGCGGTTAA