SecReT6
Protein ID: 78065035
SecReT6 ID104
T6SS typei4b
Gene symbol-
Locus tagBcep18194_A3559
StrainBurkholderia sp. 383
Repliconchromosome 1 [GenBank: NC_007510] [Browse all T6SS(s) in this replicon]
Location [Strand]424831..425346 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ39K56
KEGG IDbur:Bcep18194_A3559
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.60E-59, Aligned region: 11..163
Protein Sequence: 171 a.a.     [Download]
>gi|78065035|ref|YP_367804.1| unnamed protein product [Burkholderia sp. 383]
MAKKESIQKSLQKIRPPRVQLTYEVEKGDAIEVKELPFVVGVVGDLAGQSEIEQPKLRDRKFVNIDRDNF
DDVMKAIEPRAAFQVENRLSPEGGKFAVDLKFRSLSDFSPDEVVEQVEPLRRLLEARSKLADLRNKLAGN
DKLEDLLSEVLKNTQQLQELAKGTGGDKDGE
 
Nucleotide Sequence: 516 bp     [Download]
>gi|78064658|ref|NC_007510.1|:424831-425346 Burkholderia sp. 383 chromosome 1, complete sequence
ATGGCCAAGAAAGAAAGCATTCAGAAAAGCTTGCAGAAAATACGGCCGCCGCGCGTCCAACTGACCTACG
AGGTCGAGAAGGGCGATGCGATCGAGGTGAAGGAACTGCCGTTCGTCGTCGGGGTCGTCGGCGATCTGGC
GGGCCAGTCCGAAATCGAGCAGCCGAAGCTGCGCGACCGTAAATTCGTCAACATCGATCGCGACAATTTC
GACGATGTGATGAAGGCGATCGAGCCGCGTGCCGCGTTCCAGGTGGAAAACCGCCTGAGCCCGGAAGGCG
GCAAGTTCGCGGTCGACCTGAAGTTCCGTTCGCTGTCGGATTTCAGCCCGGACGAAGTCGTCGAACAGGT
CGAGCCGCTGCGCCGCCTGCTCGAGGCGCGCTCGAAGCTCGCCGACCTGCGCAACAAGCTTGCCGGCAAC
GACAAGCTCGAGGATCTGCTGTCCGAAGTGCTGAAGAACACGCAGCAGCTGCAGGAGCTCGCGAAGGGCA
CGGGCGGCGACAAAGACGGCGAATGA