SecReT6
Protein ID: 78065036
SecReT6 ID104
T6SS typei4b
Gene symbol-
Locus tagBcep18194_A3560
StrainBurkholderia sp. 383
Repliconchromosome 1 [GenBank: NC_007510] [Browse all T6SS(s) in this replicon]
Location [Strand]425362..426852 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ39K55
KEGG IDbur:Bcep18194_A3560
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.20E-191, Aligned region: 67..491
Protein Sequence: 496 a.a.     [Download]
>gi|78065036|ref|YP_367805.1| unnamed protein product [Burkholderia sp. 383]
MNQQTAAAQASGADYAAGTSLLDDIVEKSKVAKSDSEHARAKDLIGELVHQVLDGTVIVSDNLSATIDAR
VAELDRLISTQLSAVMHAPEFQRLESTWRGMDYLVKESNTGQTIKIKALHAPKRDLVRDFKGASEFDQSA
LFKKVYEEEFGTFGGSPFGALIGDYEISRQPEDMYFIEQMSHVAAAAHAPFIASASPELLGLESFSDLGK
PRDLGKVFDTVEYAKWKSFRDAEDSRYVGLTLPRFLGRLPFNPKDGQTAENFNFVEDVDGTDHDKYLWCN
AAWAFAARLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEVALKCPTEIAITDRREKELSDLGFI
PLVHCKNSDYAAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFASAQNV
ETFLNRWISQYVLLDDNASQEQKAQFPLREASIQVSEIPGKPGSYRSVAFLRPHFQLDELSISLRLVADL
PKPANS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|78064658|ref|NC_007510.1|:425362-426852 Burkholderia sp. 383 chromosome 1, complete sequence
ATGAACCAGCAAACGGCTGCGGCCCAAGCGAGCGGCGCGGATTACGCCGCCGGGACTTCGCTGCTCGACG
ACATCGTCGAGAAGAGCAAGGTCGCGAAATCCGATTCCGAGCATGCGCGTGCGAAGGACCTGATCGGCGA
ACTCGTGCACCAGGTGCTCGACGGCACGGTGATCGTGTCGGACAACCTGTCGGCCACGATCGACGCGCGC
GTCGCGGAACTGGACCGCCTGATTTCCACGCAGCTTTCCGCAGTGATGCACGCGCCGGAGTTCCAGCGCC
TCGAAAGCACGTGGCGCGGGATGGACTACCTGGTCAAGGAAAGCAACACCGGCCAGACGATCAAGATCAA
GGCGCTGCACGCACCGAAGCGCGACCTCGTGCGCGACTTCAAGGGCGCGAGCGAGTTCGACCAGAGCGCG
CTGTTCAAGAAGGTCTACGAAGAAGAATTCGGCACGTTCGGCGGTTCGCCGTTCGGTGCGCTGATCGGCG
ATTACGAGATCTCGCGCCAGCCGGAAGACATGTACTTCATCGAGCAGATGTCGCACGTCGCGGCGGCCGC
GCATGCGCCGTTCATCGCGTCGGCATCGCCGGAGCTGCTCGGCCTCGAGTCGTTCTCCGACCTCGGCAAG
CCGCGCGACCTCGGCAAGGTGTTCGATACGGTCGAATATGCGAAGTGGAAGTCGTTCCGCGACGCCGAAG
ATTCGCGCTACGTCGGCCTGACGCTGCCGCGCTTCCTCGGCCGCCTGCCGTTCAATCCGAAGGACGGCCA
GACGGCGGAGAACTTCAACTTCGTCGAGGACGTCGACGGCACCGACCACGACAAGTACCTGTGGTGCAAC
GCCGCGTGGGCGTTTGCTGCGCGCCTGACGGCCGCATTCGACGACTTCGGCTGGTGCGCGGCGATCCGCG
GCGTCGAAGGCGGCGGCCTCGTCGAGGACCTGCCGACCCACACGTTCAAGACCGACGACGGTGAAGTCGC
GCTGAAGTGCCCGACCGAAATCGCGATCACCGATCGCCGCGAGAAGGAGCTGAGCGACCTCGGCTTCATC
CCGCTCGTCCATTGCAAGAACTCAGATTACGCCGCGTTCTTCGCTGCGCAGTCGGTGCAGAAACCCAAGA
AATACAGCACCGACAGCGCGAATGCGAACGCCGTCCTGTCCGCCCAGCTTCAGTACATCTTCTCGGTATC
GCGCGTCGCGCACTACCTGAAGGCGATGATGCGGGACAAGATCGGCAGCTTCGCATCGGCGCAGAACGTG
GAGACTTTCCTTAACCGGTGGATTTCGCAGTACGTCCTGCTCGACGATAACGCCTCGCAGGAACAGAAAG
CGCAATTTCCGCTGCGCGAGGCATCCATACAAGTGTCAGAGATTCCGGGCAAGCCGGGCTCGTATCGTTC
GGTCGCGTTCCTGCGCCCGCACTTTCAGCTCGACGAACTCTCGATATCTCTGCGACTTGTCGCTGATCTG
CCCAAACCGGCAAATTCATAA