SecReT6
Protein ID: 78065038
SecReT6 ID104
T6SS typei4b
Gene symbol-
Locus tagBcep18194_A3562
StrainBurkholderia sp. 383
Repliconchromosome 1 [GenBank: NC_007510] [Browse all T6SS(s) in this replicon]
Location [Strand]427490..427975 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ39K53
KEGG IDbur:Bcep18194_A3562
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.70E-22, Aligned region: 29..137
Protein Sequence: 161 a.a.     [Download]
>gi|78065038|ref|YP_367807.1| unnamed protein product [Burkholderia sp. 383]
MKRFEPSFLDKLFDDEPHLPASAAMRQLSLDELKNTVARDVEAILNTRIAHTENELAALPECQKSVLTYG
LNDFAGLSLASHYDRAFICKSIQQAIARHEPRLQQVQVTFELNEQATNALYFAIQALLVVHPAEEPVSFD
AMLQPSTLQYSVTRARAARMQ
 
Nucleotide Sequence: 486 bp     [Download]
>gi|78064658|ref|NC_007510.1|:427490-427975 Burkholderia sp. 383 chromosome 1, complete sequence
ATGAAACGATTCGAACCCAGTTTTCTCGACAAGCTGTTCGACGACGAACCGCACCTGCCGGCCTCGGCAG
CGATGCGGCAATTGTCGCTGGACGAGCTCAAGAACACGGTCGCCCGCGACGTCGAGGCGATTCTCAACAC
CCGTATCGCCCACACCGAGAACGAACTGGCCGCGCTGCCGGAGTGCCAGAAGTCGGTGCTGACCTACGGG
CTGAACGATTTTGCGGGGCTGAGCCTGGCGAGTCACTATGACCGCGCGTTCATCTGCAAGTCGATCCAGC
AGGCCATCGCACGGCACGAGCCGCGCCTGCAGCAGGTGCAGGTGACGTTCGAGCTGAACGAGCAGGCCAC
CAACGCGCTTTACTTCGCGATTCAGGCGCTGCTCGTCGTGCACCCGGCCGAAGAGCCGGTGAGTTTCGAC
GCGATGCTGCAGCCCTCGACGCTGCAGTATTCGGTCACGCGCGCACGCGCCGCAAGAATGCAGTAA