SecReT6
Protein ID: 78065039
SecReT6 ID104
T6SS typei4b
Gene symbol-
Locus tagBcep18194_A3563
StrainBurkholderia sp. 383
Repliconchromosome 1 [GenBank: NC_007510] [Browse all T6SS(s) in this replicon]
Location [Strand]428053..429888 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ39K52
KEGG IDbur:Bcep18194_A3563
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-215, Aligned region: 4..610
Protein Sequence: 611 a.a.     [Download]
>gi|78065039|ref|YP_367808.1| unnamed protein product [Burkholderia sp. 383]
MEELLPYYERELSFLRRYSRDFAERYPKIAARLALSGEHCEDPHVERMIESFALLGARINKKLDDDYPEF
TEALLEVLYPHYLRPFPSCSIAQFTPASPGQQTEPVVINRGTELKSRPIRGVQCRFRTAYDVTLAPIRIS
EARYTPVALAPSATVLPSNATGVISITFESLAAQLDLGALKLPTLRAHLHGEQSFVAALTDCLFVNVLGA
YVEPERNGRWTALRKLPIAHAGFDEDDALIDYPAKSHPAYRLLTEYFAFPDKFDFVDFDIAAIARATGRC
QRATLHLVLQDVRSDSHVARLLELLTASHFRLFCTPIVNLFRQHGEPIRITHRAVSYPVIAEARRAFAYE
VYSIDSVKLVRQQAHEESVIEFRPFYSLHHGESARIGHYWFARRNDWVAQKSPGYETEISIVDIDFEPTS
PQTDTLSLDLTCTNRDLPAMLAFGLEGGDLFQEGGAQTSGISLLRRPTQSVRFERGRAAHWRLVSHLALN
HVSLVAHGLAPLKEMLTLYDLRRTAVSMRQIDGLAGVEQRGAVQWLPGKPFATFVRGIEIRLTIDEEHFV
GASLASFIRVLDSFFGLYVHLNSFVQLVVVSKRTGEEIIRCKPRTGESILA
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|78064658|ref|NC_007510.1|:428053-429888 Burkholderia sp. 383 chromosome 1, complete sequence
ATGGAAGAATTGCTGCCGTATTACGAGCGCGAATTATCGTTTTTGCGGCGCTATTCGCGAGATTTCGCCG
AACGCTATCCGAAGATCGCGGCGCGGCTCGCGTTGTCCGGCGAGCATTGCGAGGATCCGCACGTCGAGCG
GATGATCGAGTCGTTTGCGCTGCTCGGCGCGCGTATCAACAAGAAGCTCGACGACGATTACCCGGAATTC
ACCGAAGCGCTGCTGGAAGTGCTGTATCCGCACTACCTGCGGCCGTTCCCGTCGTGCTCGATCGCGCAGT
TCACGCCGGCGTCGCCCGGCCAGCAGACCGAGCCGGTCGTGATCAATCGCGGCACCGAGCTGAAGAGCCG
CCCGATCCGCGGCGTGCAGTGCCGGTTCCGCACCGCCTATGACGTGACGCTCGCGCCGATCCGCATCTCG
GAGGCGCGCTATACGCCGGTCGCGCTCGCGCCGAGCGCGACGGTGCTGCCGTCCAATGCGACGGGCGTGA
TCTCGATCACGTTCGAATCGCTCGCCGCGCAGCTCGATCTCGGCGCGCTGAAGCTGCCGACGCTGCGCGC
GCACCTGCACGGCGAGCAGTCGTTCGTCGCCGCGCTGACCGACTGCCTGTTCGTCAACGTGCTCGGCGCA
TACGTCGAGCCCGAACGCAACGGCCGCTGGACCGCGCTGCGCAAGCTGCCGATCGCGCACGCCGGCTTCG
ACGAGGACGACGCGCTGATCGACTACCCGGCGAAATCGCATCCCGCGTATCGCCTGCTCACCGAATACTT
CGCGTTCCCCGACAAGTTCGATTTCGTCGACTTCGACATCGCGGCGATCGCGCGCGCGACGGGCCGCTGC
CAGCGCGCGACGCTGCATCTCGTGCTGCAGGACGTGCGCAGCGATTCGCACGTCGCGCGGCTGCTCGAAC
TGCTGACGGCGAGCCACTTCCGGCTGTTCTGCACGCCGATCGTCAACCTGTTCCGCCAGCACGGCGAGCC
GATCCGCATCACGCACCGCGCGGTGTCCTACCCGGTGATCGCCGAGGCGCGGCGCGCATTCGCGTACGAG
GTGTATTCGATCGACTCGGTGAAGCTCGTCAGGCAGCAGGCGCACGAGGAATCGGTGATCGAGTTCCGGC
CGTTCTATTCGCTGCATCACGGCGAATCGGCGCGGATCGGCCATTACTGGTTCGCGCGCCGCAACGACTG
GGTCGCGCAGAAGAGCCCCGGTTATGAAACCGAGATCTCGATCGTCGACATCGATTTCGAGCCGACGTCG
CCGCAGACCGACACGCTGAGCCTCGACCTCACCTGCACGAACCGCGACCTGCCGGCGATGCTCGCATTCG
GGCTCGAAGGCGGCGATCTGTTCCAGGAAGGCGGCGCGCAGACGAGCGGCATTTCGCTGCTGCGCCGCCC
GACGCAGAGCGTGCGCTTCGAGCGCGGCCGCGCCGCGCACTGGCGGCTCGTGTCGCACCTCGCGCTCAAT
CACGTGTCGCTGGTCGCGCACGGCCTCGCGCCGCTGAAGGAAATGCTGACGCTGTACGACCTGCGGCGCA
CGGCGGTGTCGATGCGCCAGATCGACGGCCTCGCCGGCGTCGAGCAGCGCGGCGCCGTGCAGTGGCTGCC
CGGCAAGCCGTTCGCGACCTTCGTGCGCGGCATCGAGATCCGCCTGACGATCGACGAGGAACACTTCGTC
GGTGCGAGCCTCGCGTCGTTCATACGCGTGCTCGACAGCTTCTTCGGGCTGTACGTCCACCTCAACAGTT
TCGTTCAACTAGTCGTCGTGTCGAAGCGCACCGGCGAGGAGATCATCCGATGCAAGCCCCGCACCGGCGA
ATCGATCCTGGCGTAG