SecReT6
Protein ID: 78065040
SecReT6 ID104
T6SS typei4b
Gene symbol-
Locus tagBcep18194_A3564
StrainBurkholderia sp. 383
Repliconchromosome 1 [GenBank: NC_007510] [Browse all T6SS(s) in this replicon]
Location [Strand]429852..430952 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ39K51
KEGG IDbur:Bcep18194_A3564
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.20E-95, Aligned region: 18..347
Protein Sequence: 366 a.a.     [Download]
>gi|78065040|ref|YP_367809.1| unnamed protein product [Burkholderia sp. 383]
MQAPHRRIDPGVVDALLDEPHRFEFFQAVRVLEGLFARQASDAPGAWRQGDVVAQRIEFRNTLSLGFPPS
EIEGARSFDDDGTQLKTGEARGAALAAGELGHVELTPAFFGLLGGQGALPLHYTEQIVAREHLKRDHAAR
AFFDVFSNRATALFYAAWKKYRLPFHYELDRDERYLPLLLAIAGVPSDEVRDSLAAGVGGVLDEAVAGYA
LAARHRPMSAAYLQRTLSDYFRVPVKIDQFVGKWYDVPPDQLSVLGEVNAVLGATALVGERVWQRDMRAR
IVVGPLSKRDYEAFLPGGAHAIALERMLTLLAGVTLEYEVKLVLKRTEVGASVLGAGSRLGWDAFLCTRD
AIEDRSDARYELHVIH
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|78064658|ref|NC_007510.1|:429852-430952 Burkholderia sp. 383 chromosome 1, complete sequence
ATGCAAGCCCCGCACCGGCGAATCGATCCTGGCGTAGTCGACGCGCTGCTCGACGAACCGCACCGCTTCG
AGTTCTTCCAGGCCGTGCGCGTGCTCGAAGGGCTGTTCGCGCGGCAGGCGTCAGACGCGCCCGGCGCGTG
GCGGCAGGGCGACGTGGTCGCGCAGCGCATCGAATTCCGCAACACGCTGTCGCTCGGCTTTCCGCCGAGC
GAGATCGAAGGCGCGCGCTCGTTCGACGACGACGGCACCCAGCTCAAGACGGGCGAGGCGCGCGGCGCCG
CGCTCGCGGCCGGCGAGCTCGGCCACGTCGAGCTGACGCCCGCATTCTTCGGGCTGCTGGGCGGGCAGGG
CGCGCTGCCGCTGCATTACACCGAGCAGATCGTCGCGCGCGAGCACCTGAAGCGCGACCATGCGGCGCGC
GCATTCTTCGACGTGTTCTCGAACCGCGCGACCGCGCTGTTCTATGCCGCGTGGAAGAAGTACCGGCTGC
CGTTCCACTACGAGCTTGATCGCGACGAGCGCTATCTGCCGCTGCTGCTCGCGATCGCGGGCGTGCCGAG
CGACGAGGTGCGCGACAGTCTCGCGGCCGGCGTGGGCGGCGTGCTCGACGAGGCCGTCGCCGGCTATGCG
CTCGCCGCGCGGCACCGGCCGATGTCGGCTGCGTACCTGCAGCGCACGCTGTCCGACTATTTCCGCGTGC
CGGTGAAGATCGACCAGTTCGTCGGCAAGTGGTACGACGTGCCGCCCGACCAGCTGAGCGTGCTCGGCGA
AGTCAACGCGGTGCTCGGCGCGACGGCGCTCGTCGGCGAACGCGTGTGGCAGCGCGACATGCGCGCGCGG
ATCGTCGTCGGCCCGCTGTCCAAGCGCGACTACGAGGCGTTCCTGCCCGGCGGCGCGCACGCTATCGCGC
TGGAGCGGATGCTGACGCTGCTCGCCGGCGTCACGCTCGAATACGAGGTGAAGCTCGTGCTCAAGCGTAC
CGAGGTCGGCGCCAGCGTGCTCGGCGCGGGCTCGCGGCTCGGCTGGGACGCGTTCCTCTGCACGCGCGAC
GCGATCGAGGATCGCTCCGACGCCCGCTACGAGCTGCACGTGATTCACTGA