SecReT6
Protein ID: 78065041
SecReT6 ID104
T6SS typei4b
Gene symbol-
Locus tagBcep18194_A3565
StrainBurkholderia sp. 383
Repliconchromosome 1 [GenBank: NC_007510] [Browse all T6SS(s) in this replicon]
Location [Strand]430996..433665 [+]
Productchaperonin clpA/B/, ATPase
NoteTssH
UniProt IDQ39K50
KEGG IDbur:Bcep18194_A3565
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 9.40E-44, Aligned region: 231..328
AAA_2 [PF07724], Evalue: 9.40E-44, Aligned region: 619..787
AAA [PF00004], Evalue: 4.00E-19, Aligned region: 129..153
AAA [PF00004], Evalue: 4.00E-19, Aligned region: 232..345
AAA [PF00004], Evalue: 4.00E-19, Aligned region: 624..711
AAA_5 [PF07728], Evalue: 3.40E-13, Aligned region: 232..252
AAA_5 [PF07728], Evalue: 3.40E-13, Aligned region: 306..362
AAA_5 [PF07728], Evalue: 3.40E-13, Aligned region: 623..743
ClpB_D2-small [PF10431], Evalue: 6.60E-12, Aligned region: 794..870
AAA_16 [PF13191], Evalue: 1.10E-11, Aligned region: 44..74
AAA_16 [PF13191], Evalue: 1.10E-11, Aligned region: 209..256
AAA_16 [PF13191], Evalue: 1.10E-11, Aligned region: 276..310
AAA_16 [PF13191], Evalue: 1.10E-11, Aligned region: 469..539
AAA_16 [PF13191], Evalue: 1.10E-11, Aligned region: 594..659
AAA_16 [PF13191], Evalue: 1.10E-11, Aligned region: 690..712
AAA_16 [PF13191], Evalue: 1.10E-11, Aligned region: 789..829
Clp_N [PF02861], Evalue: 2.50E-07, Aligned region: 23..74
Clp_N [PF02861], Evalue: 2.50E-07, Aligned region: 113..131
Clp_N [PF02861], Evalue: 2.50E-07, Aligned region: 503..515
AAA_22 [PF13401], Evalue: 1.50E-06, Aligned region: 232..318
AAA_22 [PF13401], Evalue: 1.50E-06, Aligned region: 620..643
AAA_22 [PF13401], Evalue: 1.50E-06, Aligned region: 685..717
Sigma54_activat [PF00158], Evalue: 2.20E-06, Aligned region: 214..248
Sigma54_activat [PF00158], Evalue: 2.20E-06, Aligned region: 596..740
AAA_17 [PF13207], Evalue: 6.50E-05, Aligned region: 233..299
AAA_17 [PF13207], Evalue: 6.50E-05, Aligned region: 623..659
IstB_IS21 [PF01695], Evalue: 0.00011, Aligned region: 216..253
IstB_IS21 [PF01695], Evalue: 0.00011, Aligned region: 623..641
IstB_IS21 [PF01695], Evalue: 0.00011, Aligned region: 797..834
Arch_ATPase [PF01637], Evalue: 0.00026, Aligned region: 211..246
Arch_ATPase [PF01637], Evalue: 0.00026, Aligned region: 284..339
Arch_ATPase [PF01637], Evalue: 0.00026, Aligned region: 621..660
Arch_ATPase [PF01637], Evalue: 0.00026, Aligned region: 694..717
AAA_19 [PF13245], Evalue: 0.00055, Aligned region: 230..258
AAA_19 [PF13245], Evalue: 0.00055, Aligned region: 619..645
AAA_29 [PF13555], Evalue: 0.00069, Aligned region: 224..248
AAA_29 [PF13555], Evalue: 0.00069, Aligned region: 619..648
AAA_14 [PF13173], Evalue: 0.0009, Aligned region: 233..366
AAA_14 [PF13173], Evalue: 0.0009, Aligned region: 483..528
AAA_14 [PF13173], Evalue: 0.0009, Aligned region: 622..704
SRP54 [PF00448], Evalue: 0.0013, Aligned region: 232..253
SRP54 [PF00448], Evalue: 0.0013, Aligned region: 622..655
Zeta_toxin [PF06414], Evalue: 0.0016, Aligned region: 231..252
Zeta_toxin [PF06414], Evalue: 0.0016, Aligned region: 613..663
NACHT [PF05729], Evalue: 0.0017, Aligned region: 232..259
NACHT [PF05729], Evalue: 0.0017, Aligned region: 381..460
NACHT [PF05729], Evalue: 0.0017, Aligned region: 624..644
MobB [PF03205], Evalue: 0.002, Aligned region: 233..256
MobB [PF03205], Evalue: 0.002, Aligned region: 622..655
AAA_30 [PF13604], Evalue: 0.0021, Aligned region: 217..309
AAA_30 [PF13604], Evalue: 0.0021, Aligned region: 618..647
AAA_25 [PF13481], Evalue: 0.0041, Aligned region: 232..255
AAA_25 [PF13481], Evalue: 0.0041, Aligned region: 288..327
AAA_25 [PF13481], Evalue: 0.0041, Aligned region: 443..473
AAA_25 [PF13481], Evalue: 0.0041, Aligned region: 619..641
ResIII [PF04851], Evalue: 0.0051, Aligned region: 219..252
ResIII [PF04851], Evalue: 0.0051, Aligned region: 296..314
ResIII [PF04851], Evalue: 0.0051, Aligned region: 487..513
ResIII [PF04851], Evalue: 0.0051, Aligned region: 595..644
RNA_helicase [PF00910], Evalue: 0.008, Aligned region: 233..253
RNA_helicase [PF00910], Evalue: 0.008, Aligned region: 624..645
DEAD [PF00270], Evalue: 0.0091, Aligned region: 218..392
DEAD [PF00270], Evalue: 0.0091, Aligned region: 572..611
DEAD [PF00270], Evalue: 0.0091, Aligned region: 623..650
Protein Sequence: 889 a.a.     [Download]
>gi|78065041|ref|YP_367810.1| unnamed protein product [Burkholderia sp. 383]
MSTPLKTLITKLNPLCRHATERAASACLARGHYEVDLEHLFLALLEEATGDLPLALRASRVDPHALHADL
ERELTRLKTGNTRTPVFSVHLIALFEQAWLIASLDSQLGRIRSGHLLLALLTASDLAQFAQRMSSQFAEM
NVTDLKHKFDEIMAGSSEAGPRQADDEGSDVAPAADGMAPAAGPSKTPALDTYTTNLTQRARDGKIDPVI
GREAEIRQAIDILMRRRQNNPIMTGEAGVGKTAVVEGLALRIAADDVPPPLRGVALHVLDMGLLQAGASV
KGEFENRLKSVIDEVKKSAHPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYKK
YFEKDAALARRFQVVKVEEPSEPLAAAMLRGMSGLMEKHFNVRILDDAITEAVRLSHRYISGRQLPDKAI
SVLDTACAKVALAHSATPAAIDDTKKRIERIDAEIASLEREAAGGASHDERLGELRAARDTALEQLAKDE
ARYEAERVIVAEITELREALDKARGPSEDGQPVDVQATRDKLAERVAALHALQGGEPMVPLQVDGHVVAE
IVAAWTGIPLGRMVKDEIDTVLNLQPLLAARVIGQDHALEAIAQRVRTATASLEDPNKPRGVFMFVGPSG
VGKTETALALADILYGGERKMVTINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRNPYSVVLLDE
VEKAHPDVLEMFFQVFDKGAMDDAEGREIDFRNTLIILTSNVGSTAVMQACLNKPVEELPDPDALAETLR
PQLYKTFKPAFLGRMKVVPYYPISDDVLAEIIELKLERIRRRIETNHKAAFEWDESLVDAVLARCTEVDS
GARNVDHILNGTLLPEIAGHVLGRIADGEAIARIAVRADEAGEFTYTVE
 
Nucleotide Sequence: 2670 bp     [Download]
>gi|78064658|ref|NC_007510.1|:430996-433665 Burkholderia sp. 383 chromosome 1, complete sequence
ATGAGCACGCCTCTGAAGACCCTGATCACGAAACTGAACCCGCTGTGTCGCCACGCCACCGAGCGTGCGG
CGAGCGCGTGCCTGGCGCGCGGCCATTACGAGGTCGATCTGGAGCACCTGTTCCTCGCGTTGCTCGAGGA
AGCGACGGGCGACCTGCCGCTCGCATTGCGCGCGAGCCGCGTCGATCCGCACGCGCTGCACGCCGATCTC
GAGCGCGAACTGACGCGCCTGAAGACGGGCAACACGCGCACGCCGGTGTTCTCCGTGCACCTGATCGCGC
TGTTCGAACAGGCATGGCTGATCGCGTCGCTCGACTCGCAGCTCGGCCGCATCCGTTCGGGGCACCTGCT
GCTCGCGCTGCTGACCGCGTCCGATCTCGCGCAATTCGCGCAACGGATGTCGTCGCAGTTCGCGGAAATG
AACGTGACGGACCTGAAGCACAAGTTCGACGAGATCATGGCCGGCTCGAGCGAAGCCGGGCCGCGTCAGG
CGGACGACGAGGGTAGCGACGTCGCGCCGGCCGCCGACGGCATGGCACCCGCGGCCGGCCCGTCGAAGAC
GCCCGCGCTCGACACGTACACGACCAACCTCACGCAGCGCGCACGCGACGGCAAGATCGACCCGGTGATC
GGCCGTGAGGCCGAGATTCGCCAGGCGATCGACATCCTGATGCGCCGCCGCCAGAACAACCCGATCATGA
CCGGCGAGGCCGGTGTCGGCAAAACGGCGGTCGTCGAGGGCCTCGCGCTGCGCATCGCGGCCGACGACGT
GCCGCCGCCGTTGCGCGGCGTCGCGCTGCACGTGCTCGACATGGGGCTGCTGCAGGCCGGCGCGAGCGTG
AAGGGCGAGTTCGAGAACCGCCTGAAGAGCGTGATCGACGAGGTGAAGAAGAGCGCGCATCCGATCATCC
TGTTCATCGACGAGGCGCACACGATCATCGGCGCGGGCGGCCAGGCCGGCCAGAACGACGCGGCGAACCT
GCTGAAGCCGGCGCTTGCGCGCGGCGAGCTGCGCACGATTGCGGCGACGACGTGGAGCGAATACAAGAAG
TACTTCGAGAAGGATGCGGCGCTGGCGCGGCGCTTCCAGGTCGTGAAGGTCGAGGAGCCGAGCGAGCCGC
TCGCGGCCGCGATGCTGCGCGGGATGTCCGGCCTGATGGAGAAGCACTTCAACGTGCGGATTCTCGACGA
CGCGATCACCGAGGCCGTGCGCCTGTCGCACCGCTACATCAGCGGCCGCCAACTGCCGGACAAGGCAATC
AGCGTGCTCGACACCGCGTGCGCGAAGGTCGCGCTCGCGCACAGCGCGACGCCGGCGGCGATCGACGACA
CGAAGAAGCGCATCGAGCGGATCGACGCGGAAATCGCGTCGCTGGAGCGCGAGGCGGCCGGCGGCGCGTC
GCACGACGAGCGGCTCGGCGAGCTGCGCGCTGCGCGCGACACGGCGCTCGAACAACTGGCGAAGGACGAA
GCGCGCTATGAAGCCGAGCGCGTGATCGTCGCCGAGATCACCGAACTGCGCGAAGCGCTCGACAAGGCAC
GCGGCCCGTCGGAAGACGGCCAGCCGGTCGACGTGCAGGCCACCCGCGACAAGCTCGCGGAACGCGTCGC
GGCGCTGCACGCGCTGCAGGGCGGCGAGCCGATGGTGCCGCTGCAGGTCGATGGTCACGTGGTTGCCGAG
ATCGTCGCCGCATGGACGGGCATTCCGCTCGGCCGGATGGTGAAGGACGAGATCGACACCGTGCTGAACC
TGCAACCGCTGCTCGCCGCGCGCGTGATCGGCCAGGACCACGCGCTGGAAGCGATCGCGCAGCGCGTGCG
CACCGCGACCGCGAGCCTCGAGGATCCGAACAAGCCGCGCGGCGTGTTCATGTTCGTCGGGCCGTCGGGC
GTCGGCAAGACCGAGACGGCGCTTGCGCTGGCCGACATCCTGTACGGCGGCGAGCGCAAGATGGTCACGA
TCAACATGAGCGAGTATCAGGAAGCGCACAGCGTGTCGGGCCTGAAGGGCTCGCCGCCGGGCTACGTCGG
CTACGGCGAAGGCGGCGTGCTGACCGAGGCCGTGCGCCGCAACCCGTATTCCGTCGTGCTGCTCGACGAG
GTCGAGAAGGCGCACCCGGACGTGCTCGAGATGTTCTTCCAGGTGTTCGACAAGGGCGCGATGGACGATG
CGGAAGGGCGCGAGATCGACTTCCGCAACACGCTGATCATCCTGACGTCGAACGTCGGTTCCACCGCGGT
GATGCAGGCGTGCCTGAACAAGCCGGTCGAGGAGCTGCCCGATCCGGACGCGCTCGCCGAGACGCTGCGC
CCGCAGCTGTACAAGACCTTCAAGCCCGCATTCCTCGGGCGGATGAAGGTCGTGCCGTACTACCCGATTT
CCGACGACGTGCTGGCCGAGATCATCGAGCTGAAGCTCGAGCGGATCCGCCGCCGGATCGAGACGAACCA
CAAGGCGGCGTTCGAATGGGACGAATCGCTTGTCGATGCGGTGCTCGCGCGCTGCACCGAGGTCGATTCG
GGCGCCCGCAACGTCGACCACATCCTGAACGGCACGCTGCTGCCGGAGATCGCGGGCCACGTGCTCGGCC
GGATCGCCGACGGCGAGGCCATCGCGCGCATCGCGGTGCGCGCGGACGAGGCCGGCGAATTCACGTACAC
CGTCGAATGA