SecReT6
Protein ID: 78065042
SecReT6 ID104
T6SS typei4b
Gene symbol-
Locus tagBcep18194_A3566
StrainBurkholderia sp. 383
Repliconchromosome 1 [GenBank: NC_007510] [Browse all T6SS(s) in this replicon]
Location [Strand]433708..434829 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDQ39K49
KEGG IDbur:Bcep18194_A3566
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.10E-24, Aligned region: 55..116
Protein Sequence: 373 a.a.     [Download]
>gi|78065042|ref|YP_367811.1| unnamed protein product [Burkholderia sp. 383]
MPINLPELLTPISDASPSGDDLLFSNEFDAIQDARRYDDPTLDQGEWVTEIKEADWGFVVDHAGELLRTR
TKDLRLAVWLTEALALEDGITGLTEGYALLEGLCRDFWDTVHPLPEDDDTEHRLGNVAWLSGRTAELLRA
VPMTDGASNAFSTLDWEVAQHVAQAIKRDPEHADDIARGKPSIEQIDSSRRVTSIAFYTALLANLKAFEF
ALDAFEERLVERAGDSAPSFRQARDAFETVYRLAERFAREQGYTGSAPHTQSAPQAQPERIEPVFGNPIH
TEETHVQPQSVPRAPVTQMIAGIQNRAQAVDQLRAVARYFRQTEPHSPVAYLADKAAEWADMPLHKWLES
VVKDDGSLSHIRELLGVRPDEQS
 
Nucleotide Sequence: 1122 bp     [Download]
>gi|78064658|ref|NC_007510.1|:433708-434829 Burkholderia sp. 383 chromosome 1, complete sequence
ATGCCGATCAATCTCCCCGAGTTGCTGACGCCGATCAGCGATGCGTCGCCCAGCGGCGACGACCTGCTGT
TTTCGAACGAATTCGACGCGATCCAGGACGCGCGGCGCTACGACGATCCGACGCTCGACCAGGGCGAGTG
GGTGACCGAGATCAAGGAGGCCGACTGGGGCTTCGTGGTCGACCACGCGGGCGAGCTGTTGCGCACGCGC
ACGAAGGACCTGCGGCTCGCCGTATGGCTGACCGAGGCGCTCGCGCTGGAGGACGGCATCACCGGCCTGA
CCGAAGGCTATGCGCTGCTCGAGGGCCTGTGCCGCGACTTCTGGGACACCGTGCACCCGCTGCCCGAAGA
CGACGACACCGAGCACCGGCTCGGCAACGTCGCGTGGCTGTCCGGCCGCACGGCCGAGCTGCTGCGCGCG
GTGCCGATGACGGACGGTGCGTCGAACGCGTTCAGCACGCTCGACTGGGAAGTGGCGCAGCACGTTGCAC
AGGCGATCAAGCGCGACCCCGAACACGCGGACGACATCGCACGCGGCAAGCCGTCAATCGAGCAGATCGA
TTCGTCGCGGCGCGTGACGTCGATCGCGTTCTACACCGCGTTGCTCGCGAACCTGAAGGCGTTCGAGTTC
GCGCTCGATGCATTCGAGGAACGGCTCGTCGAGCGCGCGGGCGATTCGGCGCCGAGCTTCCGGCAGGCGC
GCGACGCATTCGAGACCGTGTACCGGCTCGCCGAGCGCTTTGCGCGCGAGCAGGGTTATACGGGCAGCGC
ACCGCACACGCAGTCGGCACCGCAGGCGCAGCCCGAGCGCATCGAGCCGGTGTTCGGCAACCCGATCCAC
ACGGAGGAGACTCACGTGCAGCCGCAGTCCGTTCCGCGCGCCCCGGTGACGCAGATGATCGCCGGCATCC
AGAACCGTGCGCAAGCCGTCGACCAGTTGCGCGCGGTCGCCCGCTATTTCCGCCAGACCGAGCCGCACAG
CCCGGTCGCGTATCTCGCCGACAAGGCCGCCGAATGGGCTGACATGCCGCTGCACAAGTGGCTCGAGAGC
GTCGTGAAGGACGACGGCTCGCTGTCGCATATTCGCGAACTGCTGGGCGTGAGGCCTGACGAGCAGTCGT
AG