SecReT6
Protein ID: 78065043
SecReT6 ID104
T6SS typei4b
Gene symbol-
Locus tagBcep18194_A3567
StrainBurkholderia sp. 383
Repliconchromosome 1 [GenBank: NC_007510] [Browse all T6SS(s) in this replicon]
Location [Strand]434898..437576 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ39K48
KEGG IDbur:Bcep18194_A3567
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.70E-71, Aligned region: 43..354
DUF2345 [PF10106], Evalue: 7.10E-61, Aligned region: 669..821
T6SS_Vgr [PF13296], Evalue: 9.90E-36, Aligned region: 525..632
Phage_base_V [PF04717], Evalue: 2.40E-20, Aligned region: 212..240
Phage_base_V [PF04717], Evalue: 2.40E-20, Aligned region: 425..515
Protein Sequence: 892 a.a.     [Download]
>gi|78065043|ref|YP_367812.1| unnamed protein product [Burkholderia sp. 383]
MNLTELAQAIRGGLIQQDRLLKTDIPSLPNNALVPRRAVICSELGRDFSVALDLVSTASDIELKTLIAQP
MTVWIQQADQSYLPINGYVHTARRLGTDGSLSGYQLTFASWMHFLKFRSDMRYWQDKPVDAILADVFDTH
PQAKGRYQFALSKPLPSRSYCRQSETDWNFVHRLMEDEGLFGFWRHAGDGSAHTLVVTDDLHALDELAPN
SVRFDRSGAGSEATGFTQWAASRTLQSSQHTTRTFDYKSPSTAGNPNGTTLPTKAGQGDLPGQMEVYEYT
GAYTYAGQDRGEHLSKIRLEQWESRAKRFFGVGGVRGIDAGRRFTLADHPEHDRDSAQDREFAALKVSRY
IENNLPISDHEANFPHSLQARLAEAKAGHGAAVAFEVGHDDGSAGFYLVEVEAQRAAVPYRSPFEHKKPV
MQLETAVVVGPKGEEVYTDELNRIKVMFVWDRQNGGTETASCWVRVVQSDTGGGYGGVHIPRIGEEVLIG
YIGGDCDRPIVMHRVYNGATKPQWHSDGILSGFRSKEYAGSGHNEMVLDDATGQNRTRLFSSSANSLLHL
GYLIEQNGNTRGAYLGSGFDLRTDTYGAVRAGQGLYVTTHPKEVNSQPLDASEAQGQLTDADGLLESMSQ
ASEMHQAESLGPGHDALKQFAEATKNSVAGASSGGRTSGGGTGDANVFKEPVMLFASPAGIGMASQQSVH
VAADRHVNLVSGQSTHLTSGKSLVASVKDKLSLFVQNAGMKLFAGKGPVEIQAHSDNVEMIAQKAIKVLS
ATASIEGVAKQEILLTAGGAYIRIKGGNIEIHAPGQIDVKGAQHAFSGPTSMHKTFKTEGRKADMRIRYV
DADGNVPHGEPIKFATEDGTEHSVALDAEGRAELKNIDFDEFVASQVKRTGE
 
Nucleotide Sequence: 2679 bp     [Download]
>gi|78064658|ref|NC_007510.1|:434898-437576 Burkholderia sp. 383 chromosome 1, complete sequence
ATGAACCTGACCGAACTGGCACAGGCGATTCGCGGTGGCCTGATTCAGCAGGATCGCCTGCTGAAGACGG
ACATCCCGTCGCTGCCGAACAACGCGCTGGTGCCGCGCCGGGCCGTGATCTGTTCCGAACTGGGGCGCGA
CTTCAGCGTGGCGCTCGACCTCGTGTCGACCGCCAGCGACATCGAGCTCAAGACGCTGATCGCGCAGCCG
ATGACGGTGTGGATCCAGCAGGCCGACCAGTCGTACCTCCCGATCAACGGCTATGTCCATACGGCGCGCC
GGCTCGGCACGGACGGCAGCCTGTCGGGCTACCAGTTGACCTTCGCGTCGTGGATGCACTTTCTCAAGTT
CCGCAGCGACATGCGGTACTGGCAGGACAAGCCGGTCGACGCGATCCTGGCCGACGTGTTCGATACGCAT
CCGCAGGCCAAGGGGCGCTATCAGTTTGCGCTGTCGAAACCGCTGCCGTCGCGGTCCTACTGCCGCCAGA
GCGAAACCGACTGGAACTTCGTGCATCGCCTGATGGAGGACGAAGGGCTGTTCGGCTTCTGGCGGCACGC
CGGGGACGGCAGCGCGCACACGCTCGTCGTGACCGACGACCTGCACGCGCTCGACGAACTGGCGCCGAAT
TCCGTCCGGTTCGACCGTTCGGGAGCCGGGAGCGAAGCCACCGGATTCACGCAGTGGGCCGCGTCGCGCA
CGTTGCAGAGTTCGCAGCACACGACGCGCACGTTCGATTACAAGTCGCCGTCGACGGCCGGCAATCCGAA
CGGCACGACGTTGCCCACGAAGGCCGGCCAGGGCGATCTGCCGGGCCAGATGGAAGTCTACGAATACACC
GGCGCATACACGTATGCGGGGCAGGATCGCGGCGAGCATCTGTCGAAGATTCGCCTTGAGCAATGGGAGT
CGCGCGCGAAGCGCTTCTTCGGCGTGGGCGGCGTGCGCGGGATCGACGCGGGGCGGCGCTTCACGCTGGC
GGATCATCCCGAGCACGATCGCGATTCGGCGCAGGACCGGGAATTCGCGGCCTTGAAGGTGTCGCGGTAC
ATCGAGAACAACCTGCCGATCTCGGACCACGAAGCGAACTTTCCGCACAGCCTGCAGGCGCGGCTCGCGG
AGGCGAAAGCCGGTCACGGTGCGGCGGTTGCGTTCGAAGTCGGTCATGACGACGGTTCGGCCGGGTTCTA
TCTCGTCGAGGTCGAAGCGCAACGCGCGGCGGTGCCGTATCGCAGCCCGTTCGAGCACAAGAAGCCCGTG
ATGCAGCTCGAGACGGCCGTCGTCGTCGGGCCGAAGGGCGAGGAGGTCTATACGGACGAGCTGAACCGGA
TCAAGGTCATGTTCGTCTGGGACCGGCAGAACGGGGGCACCGAAACCGCGTCGTGCTGGGTGCGCGTCGT
GCAGTCGGATACCGGCGGCGGCTATGGCGGCGTGCATATTCCGCGGATCGGCGAGGAAGTGCTGATCGGC
TATATCGGCGGCGACTGCGACCGGCCGATCGTCATGCATCGCGTCTACAACGGGGCGACCAAGCCGCAGT
GGCATAGCGACGGCATCCTGTCGGGCTTTCGGTCGAAGGAGTATGCGGGGTCCGGGCACAACGAGATGGT
CCTCGACGATGCGACCGGCCAGAACCGTACGCGACTGTTCAGCAGCAGCGCGAATTCGCTGCTTCACCTG
GGCTACCTGATCGAACAGAACGGCAACACGCGCGGCGCGTATCTCGGTTCGGGGTTCGACCTGCGCACGG
ATACGTACGGCGCCGTGCGCGCCGGGCAGGGGCTTTACGTGACGACGCATCCGAAAGAGGTGAACAGCCA
GCCGCTCGATGCGAGCGAAGCGCAGGGGCAACTCACGGATGCGGACGGGCTGCTGGAATCGATGTCGCAG
GCGAGTGAAATGCATCAGGCCGAAAGCCTCGGCCCCGGTCACGATGCGTTGAAGCAGTTCGCGGAAGCCA
CGAAGAACAGTGTTGCGGGGGCTTCGTCGGGCGGCAGGACCTCGGGCGGCGGAACGGGCGACGCGAATGT
GTTCAAGGAGCCGGTGATGCTGTTCGCGAGCCCGGCGGGGATCGGGATGGCGTCGCAGCAGAGCGTGCAC
GTGGCAGCGGACCGGCATGTGAACCTTGTCAGCGGTCAAAGCACGCATCTCACGAGCGGCAAGTCGCTGG
TGGCGAGCGTCAAGGACAAGCTCAGCCTGTTCGTGCAGAACGCGGGGATGAAGCTCTTTGCCGGCAAGGG
GCCGGTCGAGATCCAGGCCCACAGCGACAACGTCGAGATGATTGCGCAGAAGGCGATCAAGGTGTTGTCG
GCGACGGCATCGATCGAAGGCGTCGCGAAGCAGGAGATCCTGCTGACGGCGGGCGGTGCGTATATCCGGA
TCAAGGGCGGCAACATCGAGATTCACGCGCCGGGCCAGATCGACGTGAAGGGCGCGCAGCACGCCTTCAG
CGGTCCGACGAGCATGCACAAGACGTTCAAGACGGAAGGCCGCAAGGCGGACATGCGGATTCGCTATGTC
GACGCCGACGGCAACGTGCCGCACGGGGAGCCGATCAAGTTCGCGACCGAGGACGGGACCGAGCATAGCG
TCGCGCTCGACGCGGAAGGCCGGGCGGAATTGAAGAACATCGATTTTGACGAGTTCGTGGCCAGCCAGGT
CAAACGGACGGGAGAGTGA