SecReT6
Protein ID: 78221496
SecReT6 ID107
T6SS typei1
Gene symbol-
Locus tagGmet_0273
StrainGeobacter metallireducens GS-15
Repliconchromosome [GenBank: NC_007517] [Browse all T6SS(s) in this replicon]
Location [Strand]302320..303000 [+]
Producthypothetical protein
NoteTssL
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.10E-47, Aligned region: 1..213
Protein Sequence: 226 a.a.     [Download]
>gi|78221496|ref|YP_383243.1| unnamed protein product [Geobacter metallireducens GS-15]
MHLTDCFTELVAYVTHFLRTAAVRQPSYQEVRREIDLLLASGESCVRREGFSRDDFELARFAVCAWIDEA
VLSSAWSEKSLWLREQLQRLHYNTTEAGEEFFTRLNALGLHQREVREVYYLCLALGFTGRFCKPGDEYQL
EQVKTAQLKLLVGSSVGLPSLERTELFPEAYPAGAPAMAPARRRVGFSPLAAVCLAGPAVFFVILFFVYR
FTLSGVGENFLRTVPY
 
Nucleotide Sequence: 681 bp     [Download]
>gi|78221228|ref|NC_007517.1|:302320-303000 Geobacter metallireducens GS-15 chromosome, complete genome
ATGCATCTGACTGACTGTTTCACGGAACTGGTGGCCTATGTCACCCACTTCCTCCGCACGGCCGCGGTGC
GCCAGCCCTCCTACCAGGAGGTCCGCCGCGAAATCGACCTCCTCCTGGCCTCGGGGGAGTCGTGCGTCAG
GCGGGAGGGGTTCTCCCGCGACGACTTCGAGCTGGCCCGCTTCGCCGTCTGCGCCTGGATCGACGAGGCG
GTCCTCTCGTCGGCCTGGAGCGAGAAGAGCCTCTGGCTCCGGGAGCAGCTCCAGCGCCTCCACTACAACA
CCACCGAGGCGGGTGAGGAGTTCTTCACCAGGCTGAACGCCCTGGGGCTCCACCAGCGTGAGGTGCGGGA
GGTCTACTACCTCTGTCTCGCCCTCGGCTTCACCGGCAGGTTCTGCAAGCCGGGGGACGAGTATCAGCTG
GAGCAGGTGAAGACCGCCCAGCTGAAGCTCCTCGTGGGGAGCTCCGTGGGGCTTCCGTCCCTGGAGCGGA
CCGAGCTCTTCCCGGAGGCCTATCCGGCGGGAGCGCCCGCCATGGCTCCGGCCCGGCGCCGGGTCGGTTT
CTCCCCCCTTGCCGCCGTCTGCCTCGCCGGTCCGGCGGTGTTCTTTGTCATTCTCTTCTTCGTCTACCGC
TTCACCCTTTCGGGGGTGGGGGAGAATTTTTTAAGGACGGTGCCGTACTGA